Protein Family IF03409
Metagenome
Isolate
148
Members
67
Samples
128
Scaffolds
150.55
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_11949701|Ga0123353_119497011
- Length
- 157 aa
- Sequence
- MVNLKRKLKIALVAHDRRKTDMVEWVVFNATFLSKHTLICTGTTGGLIEDAFQEKGIKNIDVIKKKSGPLGGDAEIATMVVNKEVDFAVFLIDDLNPHPHEADIQMLLRQCRIWNIPIACNRYTADLLITSELWEDETYKPTQPRYTDFERKSDYQ*
Sample Types
Isolate
13.5%
Metagenome
86.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.8%
Blattidae
27.3%
Kalotermitidae
21.2%
Unclassified
7.6%
Termopsidae
6.1%
Rhinotermitidae
4.5%
Hodotermitidae
1.5%
Passalidae
1.5%
Tenebrionidae
1.5%
Taxonomy
Archaea
0
Bacteria
139
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 2 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 3 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 4 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 5 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 6 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 7 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 8 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 22 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 23 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 24 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 25 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 30 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 41 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 42 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 43 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 44 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 45 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 46 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 47 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 48 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 52 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 59 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 60 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 61 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 62 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 63 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 64 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 65 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 66 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 67 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_11626999 | 3300010049 | Bacteria | 800 |
| 2 | Ga0466713_084109 | 3300042602 | Bacteria | 14789 |
| 3 | Ga0466717_273909 | 3300042604 | Bacteria | 1148 |
| 4 | Ga0466716_158885 | 3300042605 | Bacteria | 13315 |
| 5 | Ga0466719_119979 | 3300042606 | Bacteria | 1689 |
| 6 | Ga0466720_111067 | 3300042607 | Bacteria | 2057 |
| 7 | Ga0466722_220328 | 3300042609 | Bacteria | 7198 |
| 8 | Ga0466733_016756 | 3300042659 | Bacteria | 85281 |
| 9 | JGI24702J35022_10002210 | 3300002462 | Bacteria | 11978 |
| 10 | Ga0072940_1044661 | 3300005200 | Bacteria | 688 |
| 11 | Ga0466715_400041 | 3300042616 | Bacteria | 26123 |
| 12 | Ga0466723_046709 | 3300042618 | Bacteria | 21444 |
| 13 | Ga0466703_063257 | 3300042636 | Bacteria | 21853 |
| 14 | Ga0466704_582225 | 3300042643 | Bacteria | 53049 |
| 15 | Ga0466690_053250 | 3300042590 | Bacteria | 9483 |
| 16 | Ga0123355_10898629 | 3300009826 | Unclassified | 963 |
| 17 | Ga0123353_11949701 | 3300010167 | Bacteria | 722 |
| 18 | Ga0466706_109799 | 3300042599 | Bacteria | 205088 |
| 19 | Ga0466716_092661 | 3300042605 | Bacteria | 34549 |
| 20 | Ga0466719_284904 | 3300042606 | Bacteria | 6152 |
| 21 | Ga0466722_027818 | 3300042609 | Bacteria | 34442 |
| 22 | Ga0466697_223606 | 3300042611 | Unclassified | 1841 |
| 23 | Ga0466705_097649 | 3300042612 | Bacteria | 8723 |
| 24 | Ga0072941_1170802 | 3300005201 | Bacteria | 764 |
| 25 | Ga0466715_072088 | 3300042616 | Bacteria | 72248 |
| 26 | Ga0466726_141041 | 3300042619 | Bacteria | 1934 |
| 27 | Ga0466728_031121 | 3300042620 | Bacteria | 29183 |
| 28 | Ga0123355_11441187 | 3300009826 | Unclassified | 677 |
| 29 | Ga0123354_10122414 | 3300010882 | Bacteria | 3349 |
| 30 | Ga0123354_10379630 | 3300010882 | Unclassified | 1222 |
| 31 | Ga0466706_251335 | 3300042599 | Bacteria | 8152 |
| 32 | Ga0466713_138565 | 3300042602 | Bacteria | 1160 |
| 33 | Ga0466712_210933 | 3300042614 | Bacteria | 1671 |
| 34 | Ga0466711_310846 | 3300042615 | Bacteria | 2521 |
| 35 | Ga0466729_297355 | 3300042621 | Bacteria | 2287 |
| 36 | Ga0466731_236043 | 3300042622 | Bacteria | 1226 |
| 37 | Ga0466727_044818 | 3300042655 | Bacteria | 2523 |
| 38 | Ga0466656_374272 | 3300042550 | Bacteria | 1411 |
| 39 | Ga0466692_190266 | 3300042591 | Bacteria | 3036 |
| 40 | Ga0466699_214214 | 3300042597 | Bacteria | 1230 |
| 41 | Ga0123356_10037592 | 3300010049 | Bacteria | 4515 |
| 42 | Ga0123356_10742151 | 3300010049 | Bacteria | 1152 |
| 43 | Ga0123353_11009901 | 3300010167 | Bacteria | 1116 |
| 44 | Ga0466713_110388 | 3300042602 | Bacteria | 29301 |
| 45 | Ga0466716_120857 | 3300042605 | Bacteria | 2730 |
| 46 | Ga0466718_128444 | 3300042617 | Bacteria | 1640 |
| 47 | Ga0466728_288317 | 3300042620 | Bacteria | 6164 |
| 48 | Ga0466728_328771 | 3300042620 | Bacteria | 3532 |
| 49 | Ga0466729_202017 | 3300042621 | Bacteria | 1075 |
| 50 | Ga0466703_093272 | 3300042636 | Bacteria | 9804 |
| 51 | Ga0466703_133991 | 3300042636 | Bacteria | 10423 |
| 52 | Ga0466708_296578 | 3300042652 | Bacteria | 35153 |
| 53 | Ga0466656_369632 | 3300042550 | Bacteria | 8292 |
| 54 | Ga0466690_024653 | 3300042590 | Bacteria | 6465 |
| 55 | Ga0466692_052400 | 3300042591 | Bacteria | 2121 |
| 56 | Ga0466700_158672 | 3300042600 | Bacteria | 66427 |
| 57 | Ga0466707_085647 | 3300042601 | Bacteria | 21728 |
| 58 | Ga0466707_235080 | 3300042601 | Bacteria | 2316 |
| 59 | Ga0466713_066743 | 3300042602 | Bacteria | 6891 |
| 60 | Ga0466716_061326 | 3300042605 | Bacteria | 14963 |
| 61 | Ga0466697_166513 | 3300042611 | Bacteria | 1129 |
| 62 | Ga0068302_10239750 | 3300005071 | Bacteria | 1655 |
| 63 | Ga0466728_055345 | 3300042620 | Bacteria | 34961 |
| 64 | Ga0466731_070745 | 3300042622 | Bacteria | 1187 |
| 65 | Ga0466704_031486 | 3300042643 | Bacteria | 13130 |
| 66 | Ga0466704_270564 | 3300042643 | Bacteria | 32820 |
| 67 | Ga0466706_138282 | 3300042599 | Bacteria | 3353 |
| 68 | Ga0466706_180367 | 3300042599 | Bacteria | 3028 |
| 69 | Ga0466713_057589 | 3300042602 | Bacteria | 4282 |
| 70 | Ga0466713_057643 | 3300042602 | Bacteria | 22721 |
| 71 | Ga0466713_079453 | 3300042602 | Bacteria | 2842 |
| 72 | Ga0466722_012122 | 3300042609 | Bacteria | 22908 |
| 73 | Ga0466732_002218 | 3300042656 | Bacteria | 30443 |
| 74 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 75 | IMNBL1DRAFT_c0087458 | 3300000062 | Bacteria | 860 |
| 76 | Ga0466728_039248 | 3300042620 | Bacteria | 21561 |
| 77 | Ga0466729_024223 | 3300042621 | Bacteria | 4462 |
| 78 | Ga0466729_051247 | 3300042621 | Bacteria | 9576 |
| 79 | Ga0466703_283307 | 3300042636 | Bacteria | 11928 |
| 80 | Ga0466709_287955 | 3300042648 | Bacteria | 134395 |
| 81 | Ga0466727_319308 | 3300042655 | Bacteria | 2125 |
| 82 | Ga0466690_433440 | 3300042590 | Bacteria | 1288 |
| 83 | Ga0466692_131879 | 3300042591 | Bacteria | 47901 |
| 84 | Ga0466696_148804 | 3300042596 | Bacteria | 8880 |
| 85 | Ga0466706_101791 | 3300042599 | Bacteria | 111447 |
| 86 | Ga0466707_226497 | 3300042601 | Bacteria | 3242 |
| 87 | Ga0466713_003262 | 3300042602 | Bacteria | 4107 |
| 88 | Ga0466713_078182 | 3300042602 | Bacteria | 4701 |
| 89 | Ga0466716_052874 | 3300042605 | Unclassified | 15011 |
| 90 | Ga0466716_179073 | 3300042605 | Bacteria | 1140 |
| 91 | Ga0466705_040615 | 3300042612 | Bacteria | 29577 |
| 92 | Ga0466733_151113 | 3300042659 | Bacteria | 7248 |
| 93 | JGI24699J35502_11133890 | 3300002509 | Bacteria | 18328 |
| 94 | Ga0068305_10119479 | 3300005083 | Bacteria | 15591 |
| 95 | Ga0466711_060218 | 3300042615 | Bacteria | 22953 |
| 96 | Ga0466715_142731 | 3300042616 | Bacteria | 4607 |
| 97 | Ga0466715_468000 | 3300042616 | Bacteria | 45095 |
| 98 | Ga0466726_166530 | 3300042619 | Bacteria | 1420 |
| 99 | Ga0466726_431193 | 3300042619 | Bacteria | 2869 |
| 100 | Ga0466728_105393 | 3300042620 | Bacteria | 69081 |
| 101 | Ga0466728_365611 | 3300042620 | Bacteria | 4748 |
| 102 | Ga0466731_043137 | 3300042622 | Unclassified | 4753 |
| 103 | Ga0466703_243433 | 3300042636 | Bacteria | 2770 |
| 104 | Ga0466709_398288 | 3300042648 | Bacteria | 2151 |
| 105 | Ga0415639_108695 | 3300038395 | Unclassified | 1540 |
| 106 | Ga0466696_421478 | 3300042596 | Bacteria | 1937 |
| 107 | Ga0123356_10247516 | 3300010049 | Unclassified | 1858 |
| 108 | Ga0123356_10671534 | 3300010049 | Unclassified | 1204 |
| 109 | Ga0466706_244144 | 3300042599 | Bacteria | 11286 |
| 110 | Ga0466707_008989 | 3300042601 | Bacteria | 1694 |
| 111 | Ga0466713_141379 | 3300042602 | Bacteria | 226907 |
| 112 | Ga0466719_372398 | 3300042606 | Bacteria | 3903 |
| 113 | Ga0466722_018131 | 3300042609 | Bacteria | 18077 |
| 114 | Ga0466733_183414 | 3300042659 | Bacteria | 71919 |
| 115 | Ga0466733_219174 | 3300042659 | Bacteria | 2584 |
| 116 | Ga0068305_10898346 | 3300005083 | Bacteria | 3927 |
| 117 | Ga0466711_113072 | 3300042615 | Bacteria | 8718 |
| 118 | Ga0466723_281926 | 3300042618 | Bacteria | 3567 |
| 119 | Ga0466726_368050 | 3300042619 | Bacteria | 1787 |
| 120 | Ga0466729_242520 | 3300042621 | Bacteria | 1404 |
| 121 | Ga0466735_080918 | 3300042624 | Bacteria | 1051 |
| 122 | Ga0466703_180935 | 3300042636 | Bacteria | 6050 |
| 123 | Ga0466704_108007 | 3300042643 | Bacteria | 33144 |
| 124 | Ga0466709_326985 | 3300042648 | Bacteria | 3538 |
| 125 | Ga0466727_288690 | 3300042655 | Bacteria | 1090 |
| 126 | Ga0466690_077343 | 3300042590 | Bacteria | 3937 |
| 127 | Ga0466690_300877 | 3300042590 | Bacteria | 10166 |
| 128 | Ga0466691_013975 | 3300042593 | Bacteria | 4314 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02142 | MGS | MGS-like domain | 33 | 119 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.