Protein Family IF03369
Metagenome
Isolate
253
Members
85
Samples
221
Scaffolds
253.71
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10986922|Ga0123353_109869222
- Length
- 305 aa
- Sequence
- LNFDGRLSFSLFLRQVFSYGKCLLRQVRRAYDSVRITAIGASMRFVSWNVNGLRAAIKKGFEESFALFEADIFALQETKLKEGQVDLNLLGYHNFWSYAEKSGYSGTAVFSKKEPLQTLHAIGIPYLDTEGRVCALEFPDFWFVNVYTPNAQPELARLNHRMAWDDAFREFCKGLEEGSLPQGYKIAAAKPVVLCGDFKVAHNEIDLKNPGPNRGNTGFSDEEREKFTRLLDSGFADTFRTLYPDLTGAYSWWSYRANARANNTGWRIDYFLVSESLVPRIRAASIYPEVLGSDHCPVALEIDL*
Sample Types
Isolate
12.7%
Metagenome
87.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.7%
Termitidae
26.5%
Kalotermitidae
16.9%
Termopsidae
4.8%
Drosophilidae
3.6%
Rhinotermitidae
3.6%
Passalidae
2.4%
Hydrophilidae
1.2%
Elmidae
1.2%
Hodotermitidae
1.2%
Nephropidae
1.2%
Blattidae
1.2%
Tenebrionidae
1.2%
Scarabaeidae
1.2%
Taxonomy
Archaea
0
Bacteria
238
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 3 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 4 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 5 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 6 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 7 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 8 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 9 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 10 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 11 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 12 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 13 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 2820866620 | Unclassified Actinobacteria Lab288P3bin139 | Isolate | Unclassified |
| 21 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 22 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 23 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 2820811576 | Unclassified Actinobacteria Nt197P3bin53 | Isolate | Unclassified |
| 33 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 34 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 35 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 36 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 37 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 38 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 41 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 42 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 43 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 44 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 45 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 46 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 47 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 48 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 49 | 2820546020 | Unclassified Firmicutes Lab288P1bin102 | Isolate | Unclassified |
| 50 | 2820721785 | Unclassified Fibrobacteres Lab288P1bin58 | Isolate | Unclassified |
| 51 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 52 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 53 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 54 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 55 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 56 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 57 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 58 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 59 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 60 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 61 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 62 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 63 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 64 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 65 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 66 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 67 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 68 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 69 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 70 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 71 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 72 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 73 | 2820450073 | Unclassified Firmicutes Lab288P3bin186 | Isolate | Unclassified |
| 74 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 75 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 76 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 77 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 78 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 79 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 80 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 81 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 82 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 83 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 84 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 85 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_123789 | 3300042656 | Bacteria | 2087 |
| 2 | Ga0466733_051406 | 3300042659 | Bacteria | 2447 |
| 3 | Ga0466723_230646 | 3300042618 | Bacteria | 3405 |
| 4 | Ga0466713_064180 | 3300042602 | Bacteria | 34816 |
| 5 | Ga0466713_102863 | 3300042602 | Bacteria | 15874 |
| 6 | Ga0466719_103906 | 3300042606 | Bacteria | 1747 |
| 7 | Ga0466698_059816 | 3300042610 | Bacteria | 1952 |
| 8 | Ga0466729_250720 | 3300042621 | Bacteria | 1797 |
| 9 | Ga0466735_103599 | 3300042624 | Bacteria | 3134 |
| 10 | Ga0466735_206051 | 3300042624 | Bacteria | 2908 |
| 11 | Ga0466702_303075 | 3300042635 | Bacteria | 2139 |
| 12 | Ga0466703_016709 | 3300042636 | Bacteria | 19839 |
| 13 | Ga0466703_109696 | 3300042636 | Bacteria | 1854 |
| 14 | Ga0466703_180843 | 3300042636 | Bacteria | 2440 |
| 15 | Ga0466703_229071 | 3300042636 | Bacteria | 4046 |
| 16 | Ga0466704_027878 | 3300042643 | Bacteria | 2339 |
| 17 | Ga0466709_248967 | 3300042648 | Bacteria | 1358 |
| 18 | Ga0466708_112485 | 3300042652 | Bacteria | 2540 |
| 19 | Ga0466708_147832 | 3300042652 | Bacteria | 3053 |
| 20 | Ga0415639_003743 | 3300038395 | Bacteria | 2665 |
| 21 | Ga0123355_10000128 | 3300009826 | Bacteria | 87781 |
| 22 | Ga0123356_10136735 | 3300010049 | Bacteria | 2410 |
| 23 | Ga0123353_10002377 | 3300010167 | Bacteria | 23373 |
| 24 | IMNBL1DRAFT_c0007234 | 3300000062 | Bacteria | 5879 |
| 25 | Ga0072940_1208559 | 3300005200 | Bacteria | 1156 |
| 26 | Ga0072941_1413760 | 3300005201 | Bacteria | 1971 |
| 27 | Ga0466705_036776 | 3300042612 | Bacteria | 3567 |
| 28 | Ga0466705_118691 | 3300042612 | Bacteria | 52756 |
| 29 | Ga0466733_019976 | 3300042659 | Bacteria | 1909 |
| 30 | Ga0466705_435531 | 3300042612 | Bacteria | 1594 |
| 31 | Ga0466712_233516 | 3300042614 | Unclassified | 1226 |
| 32 | Ga0466711_432277 | 3300042615 | Bacteria | 1244 |
| 33 | Ga0466715_165077 | 3300042616 | Bacteria | 9063 |
| 34 | Ga0466723_332976 | 3300042618 | Bacteria | 1691 |
| 35 | Ga0466726_242906 | 3300042619 | Bacteria | 1070 |
| 36 | Ga0466729_169544 | 3300042621 | Bacteria | 3731 |
| 37 | Ga0466706_160008 | 3300042599 | Bacteria | 3016 |
| 38 | Ga0466716_274986 | 3300042605 | Bacteria | 4783 |
| 39 | Ga0466729_248797 | 3300042621 | Bacteria | 1024 |
| 40 | Ga0466703_179129 | 3300042636 | Bacteria | 4160 |
| 41 | Ga0466703_377621 | 3300042636 | Bacteria | 1124 |
| 42 | Ga0466704_460937 | 3300042643 | Bacteria | 5515 |
| 43 | Ga0466690_230488 | 3300042590 | Bacteria | 2127 |
| 44 | Ga0466692_061279 | 3300042591 | Bacteria | 10581 |
| 45 | Ga0466692_114324 | 3300042591 | Bacteria | 3621 |
| 46 | Ga0466694_086071 | 3300042594 | Bacteria | 1737 |
| 47 | Ga0466696_232811 | 3300042596 | Bacteria | 3818 |
| 48 | Ga0466696_421654 | 3300042596 | Bacteria | 1077 |
| 49 | Ga0123356_10351328 | 3300010049 | Bacteria | 1598 |
| 50 | Ga0123353_10008576 | 3300010167 | Bacteria | 13986 |
| 51 | Ga0123353_10986922 | 3300010167 | Bacteria | 1134 |
| 52 | IMNBL1DRAFT_c0001314 | 3300000062 | Bacteria | 18682 |
| 53 | JGI24696J40584_12958325 | 3300002834 | Bacteria | 4038 |
| 54 | Ga0068305_10005860 | 3300005083 | Bacteria | 21090 |
| 55 | Ga0068305_10044894 | 3300005083 | Bacteria | 24731 |
| 56 | Ga0072941_1008487 | 3300005201 | Bacteria | 7936 |
| 57 | Ga0466705_397168 | 3300042612 | Bacteria | 10948 |
| 58 | Ga0466705_427471 | 3300042612 | Bacteria | 1246 |
| 59 | Ga0466715_180528 | 3300042616 | Bacteria | 2074 |
| 60 | Ga0466715_324161 | 3300042616 | Bacteria | 2602 |
| 61 | Ga0466728_051805 | 3300042620 | Unclassified | 1425 |
| 62 | Ga0466701_102031 | 3300042598 | Bacteria | 201577 |
| 63 | Ga0466714_089461 | 3300042603 | Bacteria | 5765 |
| 64 | Ga0466717_302887 | 3300042604 | Bacteria | 5969 |
| 65 | Ga0466719_519106 | 3300042606 | Bacteria | 4163 |
| 66 | Ga0466703_013112 | 3300042636 | Bacteria | 4142 |
| 67 | Ga0466703_337287 | 3300042636 | Bacteria | 3971 |
| 68 | Ga0466704_031641 | 3300042643 | Bacteria | 5444 |
| 69 | Ga0466696_156251 | 3300042596 | Bacteria | 25122 |
| 70 | Ga0466696_269471 | 3300042596 | Bacteria | 1727 |
| 71 | Ga0123355_10000714 | 3300009826 | Bacteria | 45061 |
| 72 | Ga0123355_10639846 | 3300009826 | Bacteria | 1246 |
| 73 | Ga0123356_10014032 | 3300010049 | Bacteria | 7708 |
| 74 | Ga0123353_10000358 | 3300010167 | Bacteria | 55607 |
| 75 | 2227148321 | 2225789004 | Bacteria | 1597 |
| 76 | Ga0068302_10037611 | 3300005071 | Bacteria | 1402 |
| 77 | Ga0068302_10083112 | 3300005071 | Bacteria | 3757 |
| 78 | Ga0466711_169366 | 3300042615 | Bacteria | 1069 |
| 79 | Ga0466711_236723 | 3300042615 | Bacteria | 1364 |
| 80 | Ga0466715_165337 | 3300042616 | Bacteria | 4744 |
| 81 | Ga0466715_549701 | 3300042616 | Bacteria | 2778 |
| 82 | Ga0466726_262813 | 3300042619 | Bacteria | 24433 |
| 83 | Ga0466726_422131 | 3300042619 | Bacteria | 8024 |
| 84 | Ga0466707_132813 | 3300042601 | Bacteria | 12489 |
| 85 | Ga0466707_271331 | 3300042601 | Bacteria | 5498 |
| 86 | Ga0466707_360309 | 3300042601 | Bacteria | 2087 |
| 87 | Ga0466713_004405 | 3300042602 | Bacteria | 2096 |
| 88 | Ga0466698_278451 | 3300042610 | Bacteria | 35706 |
| 89 | Ga0466704_021809 | 3300042643 | Bacteria | 2787 |
| 90 | Ga0466704_280343 | 3300042643 | Bacteria | 15689 |
| 91 | Ga0466704_480582 | 3300042643 | Unclassified | 1797 |
| 92 | Ga0466709_192258 | 3300042648 | Bacteria | 165099 |
| 93 | Ga0466708_132608 | 3300042652 | Unclassified | 4954 |
| 94 | Ga0466708_402020 | 3300042652 | Bacteria | 3958 |
| 95 | Ga0415639_071031 | 3300038395 | Unclassified | 3612 |
| 96 | Ga0466690_359569 | 3300042590 | Bacteria | 22107 |
| 97 | Ga0466693_117954 | 3300042592 | Bacteria | 4040 |
| 98 | Ga0466696_273487 | 3300042596 | Bacteria | 2986 |
| 99 | Ga0123355_10001024 | 3300009826 | Bacteria | 38844 |
| 100 | Ga0123355_10444418 | 3300009826 | Bacteria | 1639 |
| 101 | Ga0123353_10676638 | 3300010167 | Bacteria | 1454 |
| 102 | IMNBL1DRAFT_c0000930 | 3300000062 | Bacteria | 22632 |
| 103 | IMNBL1DRAFT_c0014482 | 3300000062 | Bacteria | 3478 |
| 104 | JGI24695J34938_10007966 | 3300002450 | Bacteria | 6119 |
| 105 | JGI24695J34938_10027538 | 3300002450 | Bacteria | 2685 |
| 106 | Ga0466733_141301 | 3300042659 | Bacteria | 5809 |
| 107 | Ga0466718_021012 | 3300042617 | Unclassified | 8735 |
| 108 | Ga0466728_188755 | 3300042620 | Bacteria | 29402 |
| 109 | Ga0466701_048283 | 3300042598 | Bacteria | 1037 |
| 110 | Ga0466701_086914 | 3300042598 | Bacteria | 1112 |
| 111 | Ga0466707_033496 | 3300042601 | Bacteria | 2466 |
| 112 | Ga0466707_372477 | 3300042601 | Unclassified | 2492 |
| 113 | Ga0466713_052457 | 3300042602 | Bacteria | 82842 |
| 114 | Ga0466717_301768 | 3300042604 | Bacteria | 2326 |
| 115 | Ga0466719_023303 | 3300042606 | Bacteria | 1392 |
| 116 | Ga0466722_063805 | 3300042609 | Bacteria | 20758 |
| 117 | Ga0466735_108710 | 3300042624 | Bacteria | 51028 |
| 118 | Ga0466704_240169 | 3300042643 | Bacteria | 11348 |
| 119 | Ga0466709_171230 | 3300042648 | Bacteria | 2445 |
| 120 | Ga0466724_28891 | 3300042649 | Bacteria | 455231 |
| 121 | Ga0466708_216074 | 3300042652 | Unclassified | 2921 |
| 122 | Ga0466727_214087 | 3300042655 | Bacteria | 1060 |
| 123 | Ga0466691_141435 | 3300042593 | Bacteria | 4090 |
| 124 | Ga0466694_131064 | 3300042594 | Bacteria | 6240 |
| 125 | Ga0466696_149053 | 3300042596 | Bacteria | 1932 |
| 126 | Ga0466696_174175 | 3300042596 | Bacteria | 1239 |
| 127 | Ga0466696_238421 | 3300042596 | Bacteria | 2084 |
| 128 | Ga0123355_10290790 | 3300009826 | Bacteria | 2242 |
| 129 | Ga0123356_11072346 | 3300010049 | Bacteria | 974 |
| 130 | Ga0123353_10126192 | 3300010167 | Bacteria | 4112 |
| 131 | 2227579905 | 2225789004 | Bacteria | 2522 |
| 132 | IMNBL1DRAFT_c0000066 | 3300000062 | Bacteria | 95639 |
| 133 | Ga0072941_1055231 | 3300005201 | Bacteria | 6030 |
| 134 | Ga0104048_1169632 | 3300007143 | Bacteria | 1965 |
| 135 | Ga0466705_398930 | 3300042612 | Bacteria | 1493 |
| 136 | Ga0466711_248040 | 3300042615 | Bacteria | 49378 |
| 137 | Ga0466711_273019 | 3300042615 | Bacteria | 4665 |
| 138 | Ga0466715_290152 | 3300042616 | Bacteria | 7576 |
| 139 | Ga0466723_270939 | 3300042618 | Bacteria | 3535 |
| 140 | Ga0466726_395028 | 3300042619 | Bacteria | 1052 |
| 141 | Ga0466728_150332 | 3300042620 | Bacteria | 2285 |
| 142 | Ga0466729_124679 | 3300042621 | Bacteria | 47965 |
| 143 | Ga0466700_134580 | 3300042600 | Bacteria | 2597 |
| 144 | Ga0466707_310315 | 3300042601 | Bacteria | 29806 |
| 145 | Ga0466719_053243 | 3300042606 | Bacteria | 17590 |
| 146 | Ga0466719_054048 | 3300042606 | Bacteria | 2078 |
| 147 | Ga0466719_113060 | 3300042606 | Bacteria | 20304 |
| 148 | Ga0466708_016161 | 3300042652 | Bacteria | 67736 |
| 149 | Ga0466708_157965 | 3300042652 | Bacteria | 6688 |
| 150 | Ga0466708_423112 | 3300042652 | Bacteria | 14812 |
| 151 | Ga0466692_090834 | 3300042591 | Bacteria | 16165 |
| 152 | Ga0466696_391724 | 3300042596 | Bacteria | 1271 |
| 153 | Ga0466696_429632 | 3300042596 | Bacteria | 1835 |
| 154 | Ga0123353_10038859 | 3300010167 | Unclassified | 7485 |
| 155 | Ga0123353_10134097 | 3300010167 | Bacteria | 3973 |
| 156 | 2227649616 | 2225789004 | Bacteria | 10850 |
| 157 | IMNBL1DRAFT_c0011819 | 3300000062 | Bacteria | 4044 |
| 158 | Ga0104045_1001100 | 3300007085 | Bacteria | 6238 |
| 159 | Ga0104019_1003743 | 3300007150 | Unclassified | 4632 |
| 160 | Ga0466712_048722 | 3300042614 | Bacteria | 18693 |
| 161 | Ga0466711_045666 | 3300042615 | Bacteria | 1345 |
| 162 | Ga0466711_129775 | 3300042615 | Bacteria | 3264 |
| 163 | Ga0466711_187139 | 3300042615 | Bacteria | 12512 |
| 164 | Ga0466715_109058 | 3300042616 | Bacteria | 6885 |
| 165 | Ga0466715_264597 | 3300042616 | Bacteria | 3097 |
| 166 | Ga0466715_558615 | 3300042616 | Bacteria | 22726 |
| 167 | Ga0466726_337886 | 3300042619 | Bacteria | 82898 |
| 168 | Ga0466728_016431 | 3300042620 | Bacteria | 2291 |
| 169 | Ga0466701_021588 | 3300042598 | Bacteria | 47878 |
| 170 | Ga0466707_374815 | 3300042601 | Bacteria | 8194 |
| 171 | Ga0466714_013712 | 3300042603 | Bacteria | 2998 |
| 172 | Ga0466719_285343 | 3300042606 | Bacteria | 4776 |
| 173 | Ga0466703_271857 | 3300042636 | Bacteria | 29413 |
| 174 | Ga0466704_078129 | 3300042643 | Bacteria | 18613 |
| 175 | Ga0466704_479753 | 3300042643 | Bacteria | 1306 |
| 176 | Ga0466727_165625 | 3300042655 | Bacteria | 23771 |
| 177 | Ga0466690_181577 | 3300042590 | Bacteria | 1038 |
| 178 | Ga0466692_159543 | 3300042591 | Bacteria | 3495 |
| 179 | Ga0466693_172003 | 3300042592 | Unclassified | 9794 |
| 180 | Ga0466694_065888 | 3300042594 | Bacteria | 1190 |
| 181 | Ga0466696_503926 | 3300042596 | Bacteria | 2017 |
| 182 | Ga0123357_10230844 | 3300009784 | Bacteria | 2029 |
| 183 | Ga0123355_10003679 | 3300009826 | Bacteria | 22111 |
| 184 | Ga0123355_10141889 | 3300009826 | Bacteria | 3673 |
| 185 | Ga0123356_10013599 | 3300010049 | Unclassified | 7845 |
| 186 | Ga0123353_10235339 | 3300010167 | Bacteria | 2851 |
| 187 | Ga0123353_10307318 | 3300010167 | Bacteria | 2416 |
| 188 | Ga0123353_10533573 | 3300010167 | Bacteria | 1698 |
| 189 | JGI24695J34938_10005305 | 3300002450 | Bacteria | 8086 |
| 190 | JGI24695J34938_10012698 | 3300002450 | Bacteria | 4455 |
| 191 | Ga0068305_10191668 | 3300005083 | Bacteria | 6113 |
| 192 | Ga0104048_1004057 | 3300007143 | Bacteria | 12123 |
| 193 | Ga0104048_1173608 | 3300007143 | Bacteria | 1205 |
| 194 | Ga0466705_032910 | 3300042612 | Bacteria | 11398 |
| 195 | Ga0466733_214845 | 3300042659 | Bacteria | 1336 |
| 196 | Ga0466705_436462 | 3300042612 | Bacteria | 10696 |
| 197 | Ga0466711_199156 | 3300042615 | Bacteria | 2832 |
| 198 | Ga0466715_365634 | 3300042616 | Bacteria | 10573 |
| 199 | Ga0466726_444922 | 3300042619 | Bacteria | 29682 |
| 200 | Ga0466701_082893 | 3300042598 | Bacteria | 37923 |
| 201 | Ga0466707_307722 | 3300042601 | Bacteria | 14083 |
| 202 | Ga0466713_121182 | 3300042602 | Bacteria | 11116 |
| 203 | Ga0466717_157036 | 3300042604 | Bacteria | 2032 |
| 204 | Ga0466716_123450 | 3300042605 | Bacteria | 2143 |
| 205 | Ga0466704_448859 | 3300042643 | Bacteria | 1389 |
| 206 | Ga0466704_489033 | 3300042643 | Unclassified | 7791 |
| 207 | Ga0466709_149434 | 3300042648 | Bacteria | 3760 |
| 208 | Ga0466727_336410 | 3300042655 | Bacteria | 1908 |
| 209 | Ga0415639_018929 | 3300038395 | Bacteria | 4038 |
| 210 | Ga0466693_255523 | 3300042592 | Unclassified | 1425 |
| 211 | Ga0466696_010127 | 3300042596 | Bacteria | 3775 |
| 212 | Ga0123357_10097557 | 3300009784 | Bacteria | 3802 |
| 213 | Ga0123355_10440185 | 3300009826 | Bacteria | 1651 |
| 214 | Ga0123356_10369516 | 3300010049 | Bacteria | 1564 |
| 215 | Ga0123356_10668247 | 3300010049 | Bacteria | 1207 |
| 216 | JGI24695J34938_10024377 | 3300002450 | Unclassified | 2906 |
| 217 | JGI24696J40584_12961382 | 3300002834 | Bacteria | 14638 |
| 218 | Ga0068302_10265139 | 3300005071 | Bacteria | 4458 |
| 219 | Ga0068305_10223145 | 3300005083 | Bacteria | 1001 |
| 220 | Ga0072941_1298780 | 3300005201 | Bacteria | 2910 |
| 221 | Ga0074263_106585 | 3300005485 | Bacteria | 1600 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03372 | Exo_endo_phos | Endonuclease/Exonuclease/phosphatase family | 46 | 295 | 0.74 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03372 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.