Protein Family IF03318
Metagenome
Isolate
212
Members
68
Samples
193
Scaffolds
244.42
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10526437|Ga0123353_105264372
- Length
- 288 aa
- Sequence
- MDDVKRGNRSYFGMKKQPRQPLIRTPRVRHKTIRETSDILYGFPSKKWEPDYFELQTNTVWSFPERGSWATHDSKYRGNWSPYIPRNLILRYSAKGDTVLDQFCGGGTTLVEAKLLGRNIIGVDINPKALDRCREKTAFDYPGAGQVSVCEGDARKLDFIPADSIDFVCTHPPYADIIQYSDGINGDLSFLGVDDFLKSMESVAQESYRVLKKDKFCSVLMGDTRKKGCVIPMSFNLMKIFEKAGFTLKEIIIKEQHNCRATGYWKTNSVKYNFLLLAHEYLFVWKK*
Sample Types
Isolate
8.5%
Metagenome
91.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.4%
Unclassified
28.8%
Kalotermitidae
19.7%
Rhinotermitidae
4.5%
Termopsidae
4.5%
Passalidae
3.0%
Stratiomyidae
1.5%
Hodotermitidae
1.5%
Taxonomy
Archaea
5
Bacteria
189
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 2 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 3 | 2820558799 | Unclassified Firmicutes Emb289P3bin74 | Isolate | Unclassified |
| 4 | 2773857682 | Unclassified Methanosarcinaceae Lab288P3bin112 | Isolate | Unclassified |
| 5 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 6 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 7 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 8 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 9 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 10 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 11 | 2820946191 | Unclassified Acidobacteria Nt197P3bin31 | Isolate | Unclassified |
| 12 | 2820468515 | Unclassified Firmicutes Lab288P1bin95 | Isolate | Unclassified |
| 13 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 14 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 2820680340 | Unclassified Firmicutes Co191P1bin89 | Isolate | Unclassified |
| 18 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 27 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 28 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 29 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 34 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 37 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 38 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 43 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 44 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 48 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 49 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 50 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 51 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 52 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 53 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 54 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 55 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 56 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 57 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 58 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 59 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 60 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 61 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 62 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 63 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 64 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 65 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 66 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 67 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 68 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10000193 | 3300009826 | Bacteria | 75741 |
| 2 | Ga0123355_10001634 | 3300009826 | Bacteria | 31282 |
| 3 | Ga0123353_10061638 | 3300010167 | Bacteria | 6015 |
| 4 | Ga0123353_10445876 | 3300010167 | Bacteria | 1907 |
| 5 | Ga0123353_10987797 | 3300010167 | Bacteria | 1133 |
| 6 | Ga0123354_10091659 | 3300010882 | Bacteria | 4196 |
| 7 | Ga0466707_275649 | 3300042601 | Bacteria | 5213 |
| 8 | Ga0466714_045555 | 3300042603 | Bacteria | 4592 |
| 9 | Ga0466698_043243 | 3300042610 | Bacteria | 1127 |
| 10 | Ga0466694_336441 | 3300042594 | Bacteria | 1549 |
| 11 | Ga0466696_134100 | 3300042596 | Bacteria | 1126 |
| 12 | IMNBL1DRAFT_c0007236 | 3300000062 | Bacteria | 5879 |
| 13 | JGI24695J34938_10003287 | 3300002450 | Bacteria | 11398 |
| 14 | Ga0072941_1115587 | 3300005201 | Bacteria | 3637 |
| 15 | Ga0072941_1287626 | 3300005201 | Bacteria | 3736 |
| 16 | Ga0466715_567722 | 3300042616 | Bacteria | 1619 |
| 17 | Ga0466726_249340 | 3300042619 | Unclassified | 3715 |
| 18 | Ga0466729_088232 | 3300042621 | Bacteria | 8151 |
| 19 | Ga0466729_253919 | 3300042621 | Bacteria | 1226 |
| 20 | Ga0466702_172963 | 3300042635 | Bacteria | 2057 |
| 21 | Ga0466705_189449 | 3300042612 | Bacteria | 4556 |
| 22 | Ga0123355_10382585 | 3300009826 | Bacteria | 1832 |
| 23 | Ga0123355_10778878 | 3300009826 | Bacteria | 1073 |
| 24 | Ga0123353_10193508 | 3300010167 | Bacteria | 3207 |
| 25 | Ga0123353_10196416 | 3300010167 | Bacteria | 3180 |
| 26 | Ga0123354_10041289 | 3300010882 | Bacteria | 7128 |
| 27 | Ga0466706_009287 | 3300042599 | Bacteria | 3145 |
| 28 | Ga0466706_020113 | 3300042599 | Bacteria | 1804 |
| 29 | Ga0466706_161440 | 3300042599 | Bacteria | 1788 |
| 30 | Ga0466706_186522 | 3300042599 | Bacteria | 7411 |
| 31 | Ga0466713_031510 | 3300042602 | Bacteria | 2690 |
| 32 | Ga0466713_040031 | 3300042602 | Bacteria | 2916 |
| 33 | Ga0466714_017982 | 3300042603 | Bacteria | 13145 |
| 34 | Ga0466714_152125 | 3300042603 | Bacteria | 1023 |
| 35 | Ga0466719_157550 | 3300042606 | Bacteria | 13505 |
| 36 | Ga0466698_225680 | 3300042610 | Bacteria | 1688 |
| 37 | Ga0415639_074870 | 3300038395 | Bacteria | 6459 |
| 38 | Ga0466690_265762 | 3300042590 | Unclassified | 1393 |
| 39 | Ga0466699_232473 | 3300042597 | Bacteria | 3375 |
| 40 | IMNBL1DRAFT_c0017069 | 3300000062 | Bacteria | 3076 |
| 41 | JGI24703J35330_11536264 | 3300002501 | Bacteria | 1192 |
| 42 | Ga0068305_10044054 | 3300005083 | Bacteria | 6141 |
| 43 | Ga0466711_434774 | 3300042615 | Bacteria | 5139 |
| 44 | Ga0466723_370442 | 3300042618 | Unclassified | 2709 |
| 45 | Ga0466708_050210 | 3300042652 | Bacteria | 20553 |
| 46 | Ga0123355_10011411 | 3300009826 | Bacteria | 13692 |
| 47 | Ga0123356_10001683 | 3300010049 | Bacteria | 24208 |
| 48 | Ga0123356_10120816 | 3300010049 | Bacteria | 2548 |
| 49 | Ga0123353_10668420 | 3300010167 | Bacteria | 1466 |
| 50 | Ga0466713_112568 | 3300042602 | Bacteria | 3698 |
| 51 | Ga0466714_057161 | 3300042603 | Unclassified | 2179 |
| 52 | Ga0466719_249896 | 3300042606 | Unclassified | 5665 |
| 53 | Ga0466720_018315 | 3300042607 | Bacteria | 8417 |
| 54 | Ga0466722_237145 | 3300042609 | Bacteria | 1404 |
| 55 | Ga0466722_256213 | 3300042609 | Bacteria | 3099 |
| 56 | Ga0415639_037068 | 3300038395 | Bacteria | 3719 |
| 57 | Ga0466699_376031 | 3300042597 | Bacteria | 3423 |
| 58 | JGI24698J34947_10134506 | 3300002449 | Bacteria | 1051 |
| 59 | Ga0466710_112286 | 3300042613 | Bacteria | 1000 |
| 60 | Ga0466715_204475 | 3300042616 | Bacteria | 7683 |
| 61 | Ga0466718_002359 | 3300042617 | Bacteria | 1818 |
| 62 | Ga0466718_014650 | 3300042617 | Bacteria | 2078 |
| 63 | Ga0466718_077826 | 3300042617 | Bacteria | 8588 |
| 64 | Ga0466735_211478 | 3300042624 | Bacteria | 1826 |
| 65 | Ga0123355_10000086 | 3300009826 | Bacteria | 98073 |
| 66 | Ga0123355_10002331 | 3300009826 | Bacteria | 26819 |
| 67 | Ga0123355_10097806 | 3300009826 | Bacteria | 4631 |
| 68 | Ga0123355_10439747 | 3300009826 | Bacteria | 1652 |
| 69 | Ga0123355_11166368 | 3300009826 | Bacteria | 791 |
| 70 | Ga0123356_10055900 | 3300010049 | Bacteria | 3676 |
| 71 | Ga0123356_10104524 | 3300010049 | Bacteria | 2723 |
| 72 | Ga0123353_10068566 | 3300010167 | Bacteria | 5696 |
| 73 | Ga0123353_10130973 | 3300010167 | Bacteria | 4025 |
| 74 | Ga0123353_10183692 | 3300010167 | Bacteria | 3308 |
| 75 | Ga0123353_10690835 | 3300010167 | Bacteria | 1435 |
| 76 | Ga0466706_083928 | 3300042599 | Unclassified | 5022 |
| 77 | Ga0466706_126715 | 3300042599 | Unclassified | 5741 |
| 78 | Ga0466706_165638 | 3300042599 | Bacteria | 16821 |
| 79 | Ga0466706_289512 | 3300042599 | Bacteria | 4864 |
| 80 | Ga0466719_537710 | 3300042606 | Bacteria | 1281 |
| 81 | Ga0466722_102388 | 3300042609 | Bacteria | 5869 |
| 82 | Ga0264413_128426 | 3300024493 | Bacteria | 3059 |
| 83 | Ga0415639_075684 | 3300038395 | Bacteria | 4212 |
| 84 | Ga0466694_064042 | 3300042594 | Bacteria | 3293 |
| 85 | 2227525468 | 2225789004 | Bacteria | 3255 |
| 86 | IMNBL1DRAFT_c0006832 | 3300000062 | Bacteria | 6143 |
| 87 | JGI24695J34938_10011103 | 3300002450 | Bacteria | 4876 |
| 88 | JGI24702J35022_10008022 | 3300002462 | Bacteria | 6012 |
| 89 | Ga0068305_10022132 | 3300005083 | Bacteria | 4362 |
| 90 | Ga0466711_327139 | 3300042615 | Bacteria | 19864 |
| 91 | Ga0466711_338796 | 3300042615 | Bacteria | 2416 |
| 92 | Ga0466715_177145 | 3300042616 | Bacteria | 2028 |
| 93 | Ga0466726_010011 | 3300042619 | Bacteria | 21762 |
| 94 | Ga0466702_299503 | 3300042635 | Bacteria | 1019 |
| 95 | Ga0466702_308661 | 3300042635 | Bacteria | 5972 |
| 96 | Ga0466702_444254 | 3300042635 | Bacteria | 2371 |
| 97 | Ga0466708_078161 | 3300042652 | Bacteria | 7599 |
| 98 | Ga0123357_10051824 | 3300009784 | Bacteria | 5545 |
| 99 | Ga0123355_10153244 | 3300009826 | Bacteria | 3494 |
| 100 | Ga0123355_10247144 | 3300009826 | Bacteria | 2518 |
| 101 | Ga0123356_10033536 | 3300010049 | Bacteria | 4800 |
| 102 | Ga0123356_10116205 | 3300010049 | Bacteria | 2594 |
| 103 | Ga0123353_10183249 | 3300010167 | Bacteria | 3313 |
| 104 | Ga0466706_260596 | 3300042599 | Unclassified | 1264 |
| 105 | Ga0466707_128346 | 3300042601 | Bacteria | 2565 |
| 106 | Ga0466707_196917 | 3300042601 | Bacteria | 6142 |
| 107 | Ga0466713_074945 | 3300042602 | Bacteria | 26421 |
| 108 | Ga0466713_094646 | 3300042602 | Bacteria | 6006 |
| 109 | Ga0466714_089674 | 3300042603 | Bacteria | 2214 |
| 110 | Ga0466719_390786 | 3300042606 | Bacteria | 3001 |
| 111 | Ga0415639_014471 | 3300038395 | Bacteria | 5848 |
| 112 | Ga0415639_077296 | 3300038395 | Unclassified | 4923 |
| 113 | Ga0456237_0003508 | 3300041968 | Bacteria | 2538 |
| 114 | Ga0466690_079850 | 3300042590 | Bacteria | 2352 |
| 115 | Ga0466690_317651 | 3300042590 | Bacteria | 2187 |
| 116 | Ga0466696_135343 | 3300042596 | Bacteria | 6151 |
| 117 | JGI24702J35022_10013975 | 3300002462 | Bacteria | 4437 |
| 118 | Ga0072941_1081847 | 3300005201 | Bacteria | 979 |
| 119 | Ga0466712_024505 | 3300042614 | Bacteria | 5461 |
| 120 | Ga0466711_103824 | 3300042615 | Bacteria | 1076 |
| 121 | Ga0466715_092633 | 3300042616 | Bacteria | 1464 |
| 122 | Ga0466715_513081 | 3300042616 | Bacteria | 6192 |
| 123 | Ga0466702_447996 | 3300042635 | Bacteria | 2028 |
| 124 | Ga0466705_051616 | 3300042612 | Bacteria | 3181 |
| 125 | Ga0123355_10000585 | 3300009826 | Bacteria | 49086 |
| 126 | Ga0123355_10115012 | 3300009826 | Bacteria | 4191 |
| 127 | Ga0123356_10470594 | 3300010049 | Bacteria | 1408 |
| 128 | Ga0123356_10793863 | 3300010049 | Bacteria | 1118 |
| 129 | Ga0123353_10325492 | 3300010167 | Bacteria | 2330 |
| 130 | Ga0123353_10371196 | 3300010167 | Bacteria | 2145 |
| 131 | Ga0466706_007704 | 3300042599 | Unclassified | 6814 |
| 132 | Ga0466706_205677 | 3300042599 | Bacteria | 3322 |
| 133 | Ga0466714_107217 | 3300042603 | Bacteria | 1250 |
| 134 | Ga0466717_257146 | 3300042604 | Bacteria | 1152 |
| 135 | Ga0466716_046000 | 3300042605 | Bacteria | 3976 |
| 136 | Ga0466719_259973 | 3300042606 | Bacteria | 3526 |
| 137 | Ga0466699_197180 | 3300042597 | Bacteria | 2511 |
| 138 | 2227297450 | 2225789004 | Bacteria | 6649 |
| 139 | Ga0072940_1251089 | 3300005200 | Bacteria | 1762 |
| 140 | Ga0072940_1317871 | 3300005200 | Bacteria | 1719 |
| 141 | Ga0466715_032867 | 3300042616 | Unclassified | 5179 |
| 142 | Ga0466715_626512 | 3300042616 | Unclassified | 4869 |
| 143 | Ga0466718_163197 | 3300042617 | Bacteria | 3963 |
| 144 | Ga0466726_348265 | 3300042619 | Unclassified | 1158 |
| 145 | Ga0466729_209793 | 3300042621 | Bacteria | 2040 |
| 146 | Ga0466704_035433 | 3300042643 | Bacteria | 4296 |
| 147 | Ga0466709_036109 | 3300042648 | Bacteria | 5374 |
| 148 | Ga0466727_258562 | 3300042655 | Bacteria | 1544 |
| 149 | Ga0123355_10000736 | 3300009826 | Bacteria | 44571 |
| 150 | Ga0123355_10031164 | 3300009826 | Unclassified | 8650 |
| 151 | Ga0123355_10056843 | 3300009826 | Bacteria | 6332 |
| 152 | Ga0123356_10245765 | 3300010049 | Bacteria | 1864 |
| 153 | Ga0123356_10291121 | 3300010049 | Bacteria | 1733 |
| 154 | Ga0123353_10000377 | 3300010167 | Archaea | 54635 |
| 155 | Ga0123353_10052032 | 3300010167 | Bacteria | 6538 |
| 156 | Ga0123353_10221780 | 3300010167 | Bacteria | 2955 |
| 157 | Ga0123353_10526437 | 3300010167 | Unclassified | 1713 |
| 158 | Ga0123354_10378602 | 3300010882 | Unclassified | 1225 |
| 159 | Ga0466706_283956 | 3300042599 | Bacteria | 3990 |
| 160 | Ga0466706_289020 | 3300042599 | Bacteria | 1282 |
| 161 | Ga0466719_201382 | 3300042606 | Bacteria | 1847 |
| 162 | Ga0466698_075610 | 3300042610 | Bacteria | 3066 |
| 163 | Ga0466657_045926 | 3300042582 | Archaea | 5933 |
| 164 | Ga0466693_358885 | 3300042592 | Bacteria | 1364 |
| 165 | Ga0466699_139928 | 3300042597 | Bacteria | 3711 |
| 166 | IMNBL1DRAFT_c0023601 | 3300000062 | Bacteria | 2406 |
| 167 | JGI24703J35330_11298034 | 3300002501 | Bacteria | 846 |
| 168 | Ga0466711_104192 | 3300042615 | Bacteria | 15581 |
| 169 | Ga0466711_229003 | 3300042615 | Bacteria | 4365 |
| 170 | Ga0466723_366012 | 3300042618 | Bacteria | 9855 |
| 171 | Ga0123355_10149531 | 3300009826 | Bacteria | 3552 |
| 172 | Ga0123355_10760063 | 3300009826 | Bacteria | 1093 |
| 173 | Ga0123355_10895998 | 3300009826 | Bacteria | 965 |
| 174 | Ga0123356_10000880 | 3300010049 | Bacteria | 33335 |
| 175 | Ga0123356_10017083 | 3300010049 | Bacteria | 6905 |
| 176 | Ga0123353_10373865 | 3300010167 | Bacteria | 2135 |
| 177 | Ga0123353_11449507 | 3300010167 | Unclassified | 878 |
| 178 | Ga0123354_10000435 | 3300010882 | Bacteria | 40907 |
| 179 | Ga0466706_112224 | 3300042599 | Bacteria | 1375 |
| 180 | Ga0466706_167808 | 3300042599 | Bacteria | 8502 |
| 181 | Ga0466706_278200 | 3300042599 | Bacteria | 4815 |
| 182 | Ga0466707_384416 | 3300042601 | Bacteria | 3384 |
| 183 | Ga0466698_367782 | 3300042610 | Bacteria | 2105 |
| 184 | Ga0415639_006910 | 3300038395 | Bacteria | 6928 |
| 185 | IMNBL1DRAFT_c0010996 | 3300000062 | Archaea | 4270 |
| 186 | JGI24698J34947_10006371 | 3300002449 | Bacteria | 6478 |
| 187 | Ga0072941_1016595 | 3300005201 | Bacteria | 18390 |
| 188 | Ga0466715_266179 | 3300042616 | Unclassified | 7266 |
| 189 | Ga0466715_473486 | 3300042616 | Bacteria | 1899 |
| 190 | Ga0466723_042951 | 3300042618 | Bacteria | 9011 |
| 191 | Ga0466726_394119 | 3300042619 | Bacteria | 2547 |
| 192 | Ga0466703_181788 | 3300042636 | Archaea | 3007 |
| 193 | Ga0466725_191326 | 3300042654 | Bacteria | 2025 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13649 | Methyltransf_25 | Methyltransferase domain | 99 | 170 | 0.92 |
| PF08241 | Methyltransf_11 | Methyltransferase domain | 104 | 170 | 0.91 |
| PF01170 | UPF0020 | RMKL-like, methyltransferase domain | 95 | 179 | 0.87 |
| PF01555 | N6_N4_Mtase | DNA methylase | 54 | 131 | 0.86 |
| PF13847 | Methyltransf_31 | Methyltransferase domain | 95 | 223 | 0.75 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08241 | GO:0008757 | S-adenosylmethionine-dependent methyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.