Protein Family IF03302
Metagenome
Isolate
145
Members
74
Samples
113
Scaffolds
229.65
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10477562|Ga0123353_104775622
- Length
- 267 aa
- Sequence
- MTGYDYISSNIEALRRRVEAAAEKSGRKASDIDIIAVSKTKPIEMIIAATKSGLYRFGENRAQELLEKQRAAEAYGIDTAARVIVAEPRGCSSGSTGEAADIDNGNAAGIEWHFIGSLQTNKVRQIVGRTKLIHSLDRFELADEIQRCASKRGIVVDTLVQVNIAKEDSKSGFFHENIEEILIKLSEMRNIRINGLMTIAPFVDDPEENRTFFRALNKIFVDMSMKKMDNVNMAVLSAGMSNDFEVAIEEGANMVRIGTSVFGERI*
Sample Types
Isolate
22.1%
Metagenome
77.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
29.2%
Termitidae
29.2%
Kalotermitidae
18.1%
Blattidae
13.9%
Rhinotermitidae
4.2%
Passalidae
2.8%
Hodotermitidae
1.4%
Termopsidae
1.4%
Taxonomy
Archaea
2
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 2 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 3 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 4 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 5 | 2820836992 | Unclassified Actinobacteria Lab288P4bin32 | Isolate | Unclassified |
| 6 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 7 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 8 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 9 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 10 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 14 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 15 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 16 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 19 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 20 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 21 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 33 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 34 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 35 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 38 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 39 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 40 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 46 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 47 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 48 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 49 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 50 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 51 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 52 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 53 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 54 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 55 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 56 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 57 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 58 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 59 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 60 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 61 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 62 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 63 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 64 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 65 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 66 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 67 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 68 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 69 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 70 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 71 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 72 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 73 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 74 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_259821 | 3300042612 | Bacteria | 2113 |
| 2 | Ga0466733_094999 | 3300042659 | Bacteria | 11543 |
| 3 | JGI24703J35330_11595272 | 3300002501 | Bacteria | 1356 |
| 4 | Ga0466715_107934 | 3300042616 | Bacteria | 37998 |
| 5 | Ga0466696_033860 | 3300042596 | Bacteria | 26168 |
| 6 | Ga0466699_384974 | 3300042597 | Bacteria | 3717 |
| 7 | Ga0466706_032378 | 3300042599 | Bacteria | 30404 |
| 8 | Ga0466706_172371 | 3300042599 | Bacteria | 29745 |
| 9 | Ga0466706_185797 | 3300042599 | Bacteria | 15499 |
| 10 | Ga0466716_158835 | 3300042605 | Bacteria | 1624 |
| 11 | 2227507954 | 2225789004 | Bacteria | 68559 |
| 12 | IMNBL1DRAFT_c0000719 | 3300000062 | Bacteria | 26318 |
| 13 | JGI24702J35022_10034689 | 3300002462 | Bacteria | 2699 |
| 14 | Ga0466715_261230 | 3300042616 | Bacteria | 2079 |
| 15 | Ga0466690_104317 | 3300042590 | Bacteria | 11630 |
| 16 | Ga0466706_123767 | 3300042599 | Bacteria | 4306 |
| 17 | Ga0466713_010930 | 3300042602 | Bacteria | 1489 |
| 18 | Ga0466713_052392 | 3300042602 | Bacteria | 216200 |
| 19 | Ga0466719_553205 | 3300042606 | Bacteria | 2350 |
| 20 | Ga0466719_553307 | 3300042606 | Bacteria | 1236 |
| 21 | Ga0466698_400157 | 3300042610 | Bacteria | 1265 |
| 22 | Ga0123355_10739181 | 3300009826 | Bacteria | 1116 |
| 23 | Ga0123356_10974308 | 3300010049 | Bacteria | 1018 |
| 24 | Ga0123354_10089831 | 3300010882 | Bacteria | 4260 |
| 25 | Ga0466697_263519 | 3300042611 | Bacteria | 1651 |
| 26 | Ga0466733_174480 | 3300042659 | Bacteria | 1175 |
| 27 | Ga0068302_10261581 | 3300005071 | Bacteria | 2274 |
| 28 | Ga0160452_100662 | 3300012834 | Bacteria | 17923 |
| 29 | Ga0466692_065183 | 3300042591 | Bacteria | 29706 |
| 30 | Ga0466706_151671 | 3300042599 | Bacteria | 4625 |
| 31 | Ga0466719_193891 | 3300042606 | Bacteria | 3395 |
| 32 | Ga0466719_524336 | 3300042606 | Bacteria | 382683 |
| 33 | Ga0123355_10003996 | 3300009826 | Bacteria | 21347 |
| 34 | Ga0123355_10102756 | 3300009826 | Bacteria | 4494 |
| 35 | Ga0466705_074496 | 3300042612 | Bacteria | 2742 |
| 36 | JGI24702J35022_10000438 | 3300002462 | Bacteria | 25142 |
| 37 | Ga0415639_010684 | 3300038395 | Unclassified | 1491 |
| 38 | Ga0466691_127214 | 3300042593 | Bacteria | 11182 |
| 39 | Ga0466694_262844 | 3300042594 | Bacteria | 2273 |
| 40 | Ga0466714_029359 | 3300042603 | Bacteria | 2270 |
| 41 | Ga0466714_064238 | 3300042603 | Bacteria | 1545 |
| 42 | Ga0466716_093751 | 3300042605 | Bacteria | 4551 |
| 43 | Ga0466719_415738 | 3300042606 | Bacteria | 31415 |
| 44 | Ga0466703_079143 | 3300042636 | Bacteria | 4254 |
| 45 | Ga0466703_250320 | 3300042636 | Bacteria | 592480 |
| 46 | Ga0123357_10132419 | 3300009784 | Archaea | 3098 |
| 47 | Ga0123356_10534396 | 3300010049 | Bacteria | 1332 |
| 48 | Ga0123353_10148261 | 3300010167 | Bacteria | 3749 |
| 49 | Ga0123353_10380474 | 3300010167 | Bacteria | 2111 |
| 50 | Ga0466705_208745 | 3300042612 | Bacteria | 7801 |
| 51 | Ga0466705_285725 | 3300042612 | Bacteria | 2949 |
| 52 | 2227152466 | 2225789004 | Bacteria | 1583 |
| 53 | IMNBL1DRAFT_c0027673 | 3300000062 | Bacteria | 2127 |
| 54 | AustNasuHG_c1016849 | 3300000089 | Bacteria | 2439 |
| 55 | Ga0466711_293800 | 3300042615 | Archaea | 7582 |
| 56 | Ga0456237_0006313 | 3300041968 | Bacteria | 1865 |
| 57 | Ga0466691_009517 | 3300042593 | Bacteria | 1097 |
| 58 | Ga0466691_053196 | 3300042593 | Bacteria | 5500 |
| 59 | Ga0466696_011595 | 3300042596 | Bacteria | 4838 |
| 60 | Ga0466706_180157 | 3300042599 | Bacteria | 2253 |
| 61 | Ga0466714_063647 | 3300042603 | Bacteria | 1347 |
| 62 | Ga0466714_104720 | 3300042603 | Bacteria | 6585 |
| 63 | Ga0466708_131845 | 3300042652 | Bacteria | 3640 |
| 64 | Ga0123357_10043246 | 3300009784 | Bacteria | 6121 |
| 65 | Ga0123355_10067764 | 3300009826 | Bacteria | 5742 |
| 66 | Ga0123356_10229554 | 3300010049 | Bacteria | 1919 |
| 67 | Ga0123353_10013317 | 3300010167 | Bacteria | 11774 |
| 68 | Ga0123354_10034760 | 3300010882 | Bacteria | 7879 |
| 69 | IMNBL1DRAFT_c0000028 | 3300000062 | Bacteria | 135353 |
| 70 | IMNBL1DRAFT_c0051369 | 3300000062 | Bacteria | 1298 |
| 71 | Ga0072940_1580733 | 3300005200 | Bacteria | 2126 |
| 72 | Ga0466715_084831 | 3300042616 | Unclassified | 3146 |
| 73 | Ga0466706_114969 | 3300042599 | Bacteria | 9799 |
| 74 | Ga0466700_481782 | 3300042600 | Bacteria | 1112 |
| 75 | Ga0466707_120764 | 3300042601 | Bacteria | 3073 |
| 76 | Ga0466714_011312 | 3300042603 | Bacteria | 10883 |
| 77 | Ga0466716_512378 | 3300042605 | Bacteria | 2058 |
| 78 | Ga0466719_395112 | 3300042606 | Bacteria | 1638 |
| 79 | Ga0466703_096281 | 3300042636 | Bacteria | 1411 |
| 80 | Ga0123355_10228770 | 3300009826 | Bacteria | 2660 |
| 81 | Ga0123353_10000082 | 3300010167 | Bacteria | 106066 |
| 82 | Ga0123353_10240773 | 3300010167 | Bacteria | 2811 |
| 83 | Ga0123354_10000678 | 3300010882 | Unclassified | 36133 |
| 84 | Ga0123354_10322294 | 3300010882 | Unclassified | 1424 |
| 85 | JGI24702J35022_10059969 | 3300002462 | Unclassified | 2033 |
| 86 | Ga0466715_456889 | 3300042616 | Bacteria | 238254 |
| 87 | Ga0466728_029017 | 3300042620 | Bacteria | 35653 |
| 88 | Ga0466729_106043 | 3300042621 | Bacteria | 6189 |
| 89 | Ga0466706_178778 | 3300042599 | Bacteria | 21790 |
| 90 | Ga0466700_185062 | 3300042600 | Bacteria | 1709 |
| 91 | Ga0466700_249837 | 3300042600 | Bacteria | 1255 |
| 92 | Ga0466707_232145 | 3300042601 | Bacteria | 1969 |
| 93 | Ga0466713_077242 | 3300042602 | Bacteria | 12347 |
| 94 | Ga0466716_003199 | 3300042605 | Bacteria | 14921 |
| 95 | Ga0466703_122769 | 3300042636 | Bacteria | 3183 |
| 96 | Ga0466704_545329 | 3300042643 | Bacteria | 3747 |
| 97 | Ga0123355_10000775 | 3300009826 | Bacteria | 43658 |
| 98 | Ga0123356_10000001 | 3300010049 | Bacteria | 411946 |
| 99 | Ga0123353_10477562 | 3300010167 | Bacteria | 1825 |
| 100 | Ga0466697_144079 | 3300042611 | Bacteria | 2327 |
| 101 | JGI24702J35022_10000998 | 3300002462 | Bacteria | 17737 |
| 102 | Ga0068302_10007354 | 3300005071 | Bacteria | 4120 |
| 103 | Ga0072941_1004049 | 3300005201 | Bacteria | 64418 |
| 104 | Ga0466715_199726 | 3300042616 | Bacteria | 77370 |
| 105 | Ga0466723_220805 | 3300042618 | Bacteria | 17867 |
| 106 | Ga0466690_318538 | 3300042590 | Bacteria | 1934 |
| 107 | Ga0466696_116778 | 3300042596 | Bacteria | 6285 |
| 108 | Ga0466706_173798 | 3300042599 | Bacteria | 56728 |
| 109 | Ga0466714_133124 | 3300042603 | Bacteria | 1674 |
| 110 | Ga0466719_525725 | 3300042606 | Bacteria | 1192 |
| 111 | Ga0466702_214429 | 3300042635 | Bacteria | 23846 |
| 112 | Ga0466708_143766 | 3300042652 | Bacteria | 5547 |
| 113 | Ga0123355_10292864 | 3300009826 | Bacteria | 2231 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01168 | Ala_racemase_N | Alanine racemase, N-terminal domain | 10 | 264 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.