Protein Family IF03281
Metagenome
Metatranscriptome
Isolate
434
Members
205
Samples
307
Scaffolds
122.05
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10398341|Ga0123353_103983415
- Length
- 139 aa
- Sequence
- MPVVEQGKLGKGVDSDMIQVQTRLKSADNTGAKEMMCIKVLGGSWRKYANVGDVIVASVKNAAPGGVVKKGEIVKCVVVRTRKGVRRPDGSYIRFDENAAVIIKDDKNPRGTRIFGPVARELRDKDYMKILSLAPEVL*
Sample Types
Isolate
29.3%
Metagenome
68.2%
MAG
0.0%
Metatranscriptome
2.5%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
27.8%
Termitidae
21.9%
Drosophilidae
11.2%
Apidae
6.4%
Kalotermitidae
6.4%
Tenebrionidae
3.7%
Scarabaeidae
2.7%
Pyralidae
2.7%
Formicidae
2.7%
Rhinotermitidae
2.1%
Termopsidae
2.1%
Bombycidae
1.6%
Passalidae
1.1%
Blattidae
1.1%
Curculionidae
0.5%
Elmidae
0.5%
Dytiscidae
0.5%
Gomphidae
0.5%
Ocypodidae
0.5%
Vespidae
0.5%
Hodotermitidae
0.5%
Portunidae
0.5%
Libellulidae
0.5%
Noctuidae
0.5%
Eresidae
0.5%
Culicidae
0.5%
Taxonomy
Archaea
0
Bacteria
372
Eukaryota
0
Viruses
0
Unclassified
62
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 2 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 3 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 4 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 5 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 6 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 7 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 8 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 9 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 10 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 11 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 14 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 19 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 20 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 21 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 26 | 3300021217 | Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA | Metatranscriptome | Termitidae |
| 27 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 28 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 29 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 30 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 31 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 32 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 33 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 34 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 35 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 36 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 37 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 38 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 39 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 46 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 47 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 48 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 49 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 50 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 51 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 52 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 53 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 54 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 55 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 56 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 57 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 58 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 59 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 60 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 61 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 62 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 63 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 64 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 65 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 66 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 67 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 68 | 8012112996 | Staphylococcus muscae ATCC 49910 | Isolate | |
| 69 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 70 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 71 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 72 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 73 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 74 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 75 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 76 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 77 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 78 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 79 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 80 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 81 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 82 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 83 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 84 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 85 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 86 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 87 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 88 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 89 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 90 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 91 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 92 | 2820339298 | Unclassified Firmicutes Nt197P3bin68 | Isolate | Unclassified |
| 93 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 94 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 95 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 96 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 97 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 98 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 99 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 100 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 101 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 102 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 103 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 104 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 105 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 106 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 107 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 108 | 3300005283 | Nasutitermes corniger P1 gut segment microbial communitites from University of Florida, USA - Alkaline Insect Gut Metagenome: eDNA_1 | Metagenome | Termitidae |
| 109 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 110 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 111 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 112 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 113 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 114 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 115 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 116 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 117 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 118 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 119 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 120 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 121 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 122 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 123 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 124 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 125 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 126 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 127 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 128 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 129 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 130 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 131 | 8112490586 | Staphylococcus muscae CCM 4175 | Isolate | |
| 132 | 2917496769 | Staphylococcus muscae DSM 7068 | Isolate | Unclassified |
| 133 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 134 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 135 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 136 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 137 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 138 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 139 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 140 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 141 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 142 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 143 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 144 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 145 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 146 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 147 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 148 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 149 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 150 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 151 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 152 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 153 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 154 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 155 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 156 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 157 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 158 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 159 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 160 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 161 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 162 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 163 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 164 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 165 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 166 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 167 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 168 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 169 | 2820455747 | Unclassified Firmicutes Lab288P3bin160 | Isolate | Unclassified |
| 170 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 171 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 172 | 3300060759 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_oats_a (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 173 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 174 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 175 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 176 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 177 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 178 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 179 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 180 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 181 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 182 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 183 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 184 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 185 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 186 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 187 | 3300008519 | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Neivamyrmex summichrasti Gut microbial communities of Neivamyrmex summichrasti | Metagenome | Formicidae |
| 188 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 189 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 190 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 191 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 192 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 193 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 194 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 195 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 196 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 197 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 198 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 199 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 200 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 201 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 202 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 203 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 204 | 3300021240 | Termite gut microbial communities from nest from French Guiana - 11-5 mRNA SA | Metatranscriptome | Termitidae |
| 205 | 3300026558 | Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_159300 | 3300042659 | Unclassified | 1184 |
| 2 | Ga0562374_0987 | 3300057007 | Bacteria | 37947 |
| 3 | Ga0590776_00014 | 3300060759 | Bacteria | 11180 |
| 4 | Ga0123355_10252002 | 3300009826 | Unclassified | 2484 |
| 5 | Ga0123355_10569189 | 3300009826 | Bacteria | 1360 |
| 6 | Ga0123356_10000028 | 3300010049 | Bacteria | 164875 |
| 7 | Ga0123356_10075868 | 3300010049 | Bacteria | 3167 |
| 8 | Ga0123356_10231259 | 3300010049 | Unclassified | 1913 |
| 9 | Ga0123356_10518228 | 3300010049 | Unclassified | 1350 |
| 10 | Ga0123356_10823895 | 3300010049 | Bacteria | 1099 |
| 11 | Ga0123353_10035997 | 3300010167 | Bacteria | 7750 |
| 12 | Ga0123353_10798678 | 3300010167 | Unclassified | 1303 |
| 13 | Ga0123354_10138730 | 3300010882 | Bacteria | 3023 |
| 14 | Ga0466706_003667 | 3300042599 | Bacteria | 13149 |
| 15 | Ga0466706_283805 | 3300042599 | Bacteria | 2234 |
| 16 | Ga0466714_030990 | 3300042603 | Bacteria | 2859 |
| 17 | Ga0466721_281712 | 3300042608 | Bacteria | 2617 |
| 18 | Ga0466698_337884 | 3300042610 | Bacteria | 12427 |
| 19 | Ga0466718_087822 | 3300042617 | Unclassified | 1441 |
| 20 | 2227150260 | 2225789004 | Bacteria | 8537 |
| 21 | 2227518522 | 2225789004 | Bacteria | 3386 |
| 22 | AustNasuHG_c1000039 | 3300000089 | Bacteria | 32381 |
| 23 | JGI24703J35330_11748775 | 3300002501 | Bacteria | 33848 |
| 24 | Ga0102734_1000125 | 3300007129 | Bacteria | 24932 |
| 25 | Ga0466697_168210 | 3300042611 | Bacteria | 1437 |
| 26 | Ga0466705_211599 | 3300042612 | Bacteria | 21797 |
| 27 | Ga0466727_179884 | 3300042655 | Unclassified | 2509 |
| 28 | Ga0223687_100094 | 3300021217 | Bacteria | 12922 |
| 29 | Ga0223675_1033352 | 3300021237 | Bacteria | 1048 |
| 30 | Ga0223683_1008166 | 3300021245 | Bacteria | 1484 |
| 31 | Ga0415639_001087 | 3300038395 | Bacteria | 37853 |
| 32 | Ga0466694_197325 | 3300042594 | Unclassified | 1404 |
| 33 | Ga0466696_182032 | 3300042596 | Bacteria | 2079 |
| 34 | Ga0466733_140291 | 3300042659 | Unclassified | 1082 |
| 35 | Ga0562374_0016 | 3300057007 | Bacteria | 1205025 |
| 36 | Ga0123357_10384016 | 3300009784 | Bacteria | 1299 |
| 37 | Ga0123355_10026081 | 3300009826 | Bacteria | 9422 |
| 38 | Ga0123355_10412747 | 3300009826 | Bacteria | 1732 |
| 39 | Ga0123355_10669736 | 3300009826 | Unclassified | 1203 |
| 40 | Ga0123355_11137499 | 3300009826 | Unclassified | 806 |
| 41 | Ga0123355_12109289 | 3300009826 | Unclassified | 518 |
| 42 | Ga0123356_10138406 | 3300010049 | Bacteria | 2398 |
| 43 | Ga0123353_10012761 | 3300010167 | Bacteria | 11980 |
| 44 | Ga0123353_10398341 | 3300010167 | Bacteria | 2050 |
| 45 | Ga0123353_10427162 | 3300010167 | Unclassified | 1961 |
| 46 | Ga0123353_10887676 | 3300010167 | Bacteria | 1216 |
| 47 | Ga0123353_11365099 | 3300010167 | Bacteria | 914 |
| 48 | Ga0123353_11483326 | 3300010167 | Unclassified | 865 |
| 49 | Ga0123354_10000033 | 3300010882 | Bacteria | 101764 |
| 50 | Ga0466706_013012 | 3300042599 | Bacteria | 1018 |
| 51 | Ga0466707_254889 | 3300042601 | Bacteria | 95649 |
| 52 | Ga0466707_406938 | 3300042601 | Bacteria | 47814 |
| 53 | Ga0466714_121267 | 3300042603 | Bacteria | 2134 |
| 54 | Ga0466714_164415 | 3300042603 | Bacteria | 2510 |
| 55 | Ga0466714_165025 | 3300042603 | Bacteria | 1023 |
| 56 | Ga0466721_015423 | 3300042608 | Bacteria | 14106 |
| 57 | Ga0466721_152911 | 3300042608 | Bacteria | 1057 |
| 58 | Ga0466722_033664 | 3300042609 | Bacteria | 51377 |
| 59 | Ga0466698_118649 | 3300042610 | Unclassified | 1034 |
| 60 | Ga0466710_283384 | 3300042613 | Unclassified | 2028 |
| 61 | Ga0466715_157719 | 3300042616 | Bacteria | 36534 |
| 62 | 2227494078 | 2225789004 | Bacteria | 20130 |
| 63 | Ga0466731_330004 | 3300042622 | Bacteria | 1023 |
| 64 | Ga0466734_102724 | 3300042623 | Bacteria | 2099 |
| 65 | Ga0466703_044576 | 3300042636 | Bacteria | 11813 |
| 66 | Ga0233288_1017964 | 3300022232 | Bacteria | 2320 |
| 67 | Ga0415639_007672 | 3300038395 | Bacteria | 13622 |
| 68 | Ga0415639_121180 | 3300038395 | Bacteria | 3675 |
| 69 | Ga0466657_374354 | 3300042582 | Unclassified | 1034 |
| 70 | Ga0466693_360230 | 3300042592 | Unclassified | 1198 |
| 71 | Ga0466694_241440 | 3300042594 | Bacteria | 37091 |
| 72 | Ga0466733_028737 | 3300042659 | Bacteria | 2352 |
| 73 | Ga0466733_180165 | 3300042659 | Unclassified | 1581 |
| 74 | Ga0562376_2522 | 3300056857 | Bacteria | 21571 |
| 75 | Ga0123357_10069998 | 3300009784 | Bacteria | 4662 |
| 76 | Ga0123355_10202642 | 3300009826 | Bacteria | 2894 |
| 77 | Ga0123355_10372031 | 3300009826 | Bacteria | 1871 |
| 78 | Ga0123356_10102388 | 3300010049 | Bacteria | 2749 |
| 79 | Ga0123356_11524469 | 3300010049 | Bacteria | 825 |
| 80 | Ga0123356_11974105 | 3300010049 | Unclassified | 727 |
| 81 | Ga0123353_10007664 | 3300010167 | Bacteria | 14629 |
| 82 | Ga0123353_10048563 | 3300010167 | Bacteria | 6757 |
| 83 | Ga0123353_10288501 | 3300010167 | Bacteria | 2514 |
| 84 | Ga0123353_10439960 | 3300010167 | Bacteria | 1924 |
| 85 | Ga0123353_11286429 | 3300010167 | Unclassified | 951 |
| 86 | Ga0466706_032791 | 3300042599 | Bacteria | 3728 |
| 87 | Ga0466707_031260 | 3300042601 | Bacteria | 71521 |
| 88 | Ga0466713_069636 | 3300042602 | Bacteria | 98037 |
| 89 | Ga0466713_125535 | 3300042602 | Bacteria | 3551 |
| 90 | Ga0466714_113006 | 3300042603 | Bacteria | 1285 |
| 91 | Ga0466714_155853 | 3300042603 | Bacteria | 2762 |
| 92 | Ga0466721_218303 | 3300042608 | Bacteria | 3036 |
| 93 | Ga0466705_390354 | 3300042612 | Bacteria | 2160 |
| 94 | Ga0466715_357572 | 3300042616 | Bacteria | 181743 |
| 95 | Ga0466726_048826 | 3300042619 | Bacteria | 24055 |
| 96 | Ga0466729_156092 | 3300042621 | Bacteria | 7836 |
| 97 | IMNBL1DRAFT_c0001685 | 3300000062 | Bacteria | 16309 |
| 98 | JGI24703J35330_11707738 | 3300002501 | Unclassified | 2125 |
| 99 | JGI24703J35330_11748269 | 3300002501 | Bacteria | 12890 |
| 100 | JGI24700J35501_10930786 | 3300002508 | Bacteria | 23988 |
| 101 | CVPL010L_1000082 | 3300002932 | Bacteria | 29431 |
| 102 | Ga0068302_10539229 | 3300005071 | Bacteria | 2612 |
| 103 | Ga0068305_10030243 | 3300005083 | Bacteria | 2668 |
| 104 | Ga0466697_249843 | 3300042611 | Bacteria | 1163 |
| 105 | Ga0466705_206656 | 3300042612 | Bacteria | 3350 |
| 106 | Ga0233288_1004694 | 3300022232 | Bacteria | 8300 |
| 107 | Ga0233288_1017400 | 3300022232 | Bacteria | 765 |
| 108 | Ga0415639_007671 | 3300038395 | Bacteria | 5926 |
| 109 | Ga0415639_020367 | 3300038395 | Bacteria | 13306 |
| 110 | Ga0466690_295994 | 3300042590 | Bacteria | 1931 |
| 111 | Ga0466692_026254 | 3300042591 | Bacteria | 97091 |
| 112 | Ga0466693_132598 | 3300042592 | Unclassified | 1222 |
| 113 | Ga0466732_410063 | 3300042656 | Unclassified | 3226 |
| 114 | Ga0466733_027788 | 3300042659 | Bacteria | 1224 |
| 115 | Ga0466733_172907 | 3300042659 | Bacteria | 4931 |
| 116 | Ga0562375_0174 | 3300056856 | Bacteria | 188560 |
| 117 | Ga0123357_10673667 | 3300009784 | Bacteria | 754 |
| 118 | Ga0123355_10379902 | 3300009826 | Unclassified | 1842 |
| 119 | Ga0123356_10002442 | 3300010049 | Bacteria | 19870 |
| 120 | Ga0123356_10072003 | 3300010049 | Bacteria | 3246 |
| 121 | Ga0123356_11156508 | 3300010049 | Unclassified | 941 |
| 122 | Ga0123353_10000124 | 3300010167 | Bacteria | 92555 |
| 123 | Ga0123353_10319324 | 3300010167 | Bacteria | 2358 |
| 124 | Ga0123353_10379733 | 3300010167 | Bacteria | 2114 |
| 125 | Ga0123353_10435642 | 3300010167 | Bacteria | 1936 |
| 126 | Ga0123353_10617032 | 3300010167 | Unclassified | 1545 |
| 127 | Ga0123353_10707038 | 3300010167 | Bacteria | 1413 |
| 128 | Ga0123353_10875239 | 3300010167 | Unclassified | 1227 |
| 129 | Ga0123353_12843728 | 3300010167 | Bacteria | 566 |
| 130 | Ga0466706_150646 | 3300042599 | Bacteria | 2077 |
| 131 | Ga0466706_252918 | 3300042599 | Bacteria | 2138 |
| 132 | Ga0466714_073449 | 3300042603 | Bacteria | 1335 |
| 133 | Ga0466714_122492 | 3300042603 | Bacteria | 2757 |
| 134 | Ga0466717_223973 | 3300042604 | Unclassified | 1379 |
| 135 | Ga0466722_092885 | 3300042609 | Bacteria | 2086 |
| 136 | Ga0466722_240797 | 3300042609 | Bacteria | 12349 |
| 137 | Ga0466710_094726 | 3300042613 | Bacteria | 14157 |
| 138 | Ga0466728_452942 | 3300042620 | Bacteria | 39308 |
| 139 | 2227531567 | 2225789004 | Bacteria | 3145 |
| 140 | IMNBL1DRAFT_c0006063 | 3300000062 | Bacteria | 6721 |
| 141 | JGI24702J35022_10464257 | 3300002462 | Bacteria | 772 |
| 142 | JGI24703J35330_11748856 | 3300002501 | Bacteria | 55836 |
| 143 | Ga0063521_1000130 | 3300003973 | Bacteria | 58438 |
| 144 | Ga0466730_095014 | 3300042625 | Bacteria | 15821 |
| 145 | Ga0466702_447794 | 3300042635 | Bacteria | 1991 |
| 146 | Ga0255809_1014562 | 3300022820 | Unclassified | 1322 |
| 147 | Ga0415639_069770 | 3300038395 | Bacteria | 1219 |
| 148 | Ga0415639_170993 | 3300038395 | Bacteria | 1155 |
| 149 | Ga0466690_148542 | 3300042590 | Bacteria | 12801 |
| 150 | Ga0466696_293988 | 3300042596 | Bacteria | 4873 |
| 151 | Ga0466732_318884 | 3300042656 | Bacteria | 1507 |
| 152 | Ga0466733_188704 | 3300042659 | Bacteria | 2246 |
| 153 | Ga0562375_0036 | 3300056856 | Bacteria | 609533 |
| 154 | Ga0123355_10083911 | 3300009826 | Bacteria | 5076 |
| 155 | Ga0123355_10430426 | 3300009826 | Unclassified | 1679 |
| 156 | Ga0123355_11004837 | 3300009826 | Bacteria | 885 |
| 157 | Ga0123355_11713533 | 3300009826 | Bacteria | 598 |
| 158 | Ga0123356_10008505 | 3300010049 | Bacteria | 10199 |
| 159 | Ga0123356_10184326 | 3300010049 | Bacteria | 2112 |
| 160 | Ga0123356_13888125 | 3300010049 | Bacteria | 515 |
| 161 | Ga0123353_10230863 | 3300010167 | Bacteria | 2885 |
| 162 | Ga0123353_10348980 | 3300010167 | Bacteria | 2231 |
| 163 | Ga0123353_10877536 | 3300010167 | Unclassified | 1225 |
| 164 | Ga0466706_198004 | 3300042599 | Bacteria | 4840 |
| 165 | Ga0466706_215819 | 3300042599 | Bacteria | 3628 |
| 166 | Ga0466700_202321 | 3300042600 | Bacteria | 13188 |
| 167 | Ga0466707_098926 | 3300042601 | Bacteria | 16720 |
| 168 | Ga0466717_039105 | 3300042604 | Unclassified | 1255 |
| 169 | Ga0466722_238982 | 3300042609 | Bacteria | 5314 |
| 170 | Ga0466698_448924 | 3300042610 | Bacteria | 6732 |
| 171 | Ga0466710_395115 | 3300042613 | Bacteria | 1440 |
| 172 | Ga0466711_327783 | 3300042615 | Bacteria | 14489 |
| 173 | IMNBL1DRAFT_c0003704 | 3300000062 | Bacteria | 9614 |
| 174 | JGI24695J34938_10003848 | 3300002450 | Bacteria | 10185 |
| 175 | JGI24702J35022_10000742 | 3300002462 | Bacteria | 20088 |
| 176 | Ga0072940_1241986 | 3300005200 | Bacteria | 4194 |
| 177 | Ga0466735_129010 | 3300042624 | Unclassified | 1000 |
| 178 | Ga0466702_180988 | 3300042635 | Bacteria | 12693 |
| 179 | Ga0466702_229822 | 3300042635 | Bacteria | 1314 |
| 180 | Ga0415639_001377 | 3300038395 | Bacteria | 23349 |
| 181 | Ga0415639_006405 | 3300038395 | Bacteria | 33378 |
| 182 | Ga0415639_007670 | 3300038395 | Bacteria | 6074 |
| 183 | Ga0415639_019174 | 3300038395 | Bacteria | 27021 |
| 184 | Ga0466657_142036 | 3300042582 | Bacteria | 2616 |
| 185 | Ga0466691_105136 | 3300042593 | Bacteria | 11830 |
| 186 | Ga0466733_130542 | 3300042659 | Bacteria | 2239 |
| 187 | Ga0466733_156936 | 3300042659 | Bacteria | 1493 |
| 188 | Ga0562379_1450 | 3300056790 | Unclassified | 26930 |
| 189 | Ga0562377_0321 | 3300056842 | Bacteria | 96324 |
| 190 | Ga0123355_10005639 | 3300009826 | Bacteria | 18376 |
| 191 | Ga0123355_10006928 | 3300009826 | Bacteria | 16875 |
| 192 | Ga0123355_10219214 | 3300009826 | Bacteria | 2740 |
| 193 | Ga0123356_10218072 | 3300010049 | Bacteria | 1962 |
| 194 | Ga0123356_10229633 | 3300010049 | Bacteria | 1919 |
| 195 | Ga0123356_10857824 | 3300010049 | Bacteria | 1079 |
| 196 | Ga0123356_12402080 | 3300010049 | Unclassified | 659 |
| 197 | Ga0123356_13577995 | 3300010049 | Bacteria | 538 |
| 198 | Ga0123353_10000031 | 3300010167 | Bacteria | 160211 |
| 199 | Ga0123353_10198186 | 3300010167 | Bacteria | 3162 |
| 200 | Ga0123353_10223249 | 3300010167 | Bacteria | 2944 |
| 201 | Ga0123353_10260415 | 3300010167 | Bacteria | 2679 |
| 202 | Ga0123353_10492801 | 3300010167 | Bacteria | 1788 |
| 203 | Ga0123353_10686378 | 3300010167 | Bacteria | 1441 |
| 204 | Ga0123354_10205816 | 3300010882 | Bacteria | 2146 |
| 205 | Ga0466701_084903 | 3300042598 | Bacteria | 2265 |
| 206 | Ga0466706_273779 | 3300042599 | Bacteria | 3344 |
| 207 | Ga0466700_321744 | 3300042600 | Bacteria | 1581 |
| 208 | Ga0466700_389389 | 3300042600 | Unclassified | 2285 |
| 209 | Ga0466707_262676 | 3300042601 | Bacteria | 90434 |
| 210 | Ga0466707_372990 | 3300042601 | Bacteria | 91697 |
| 211 | Ga0466717_125060 | 3300042604 | Bacteria | 2040 |
| 212 | Ga0466719_280925 | 3300042606 | Bacteria | 2007 |
| 213 | Ga0466719_373723 | 3300042606 | Bacteria | 19766 |
| 214 | Ga0466722_160820 | 3300042609 | Bacteria | 3766 |
| 215 | Ga0466698_428023 | 3300042610 | Bacteria | 1317 |
| 216 | Ga0466718_123034 | 3300042617 | Unclassified | 2813 |
| 217 | 2227505172 | 2225789004 | Bacteria | 19004 |
| 218 | Ga0068305_10179549 | 3300005083 | Bacteria | 2287 |
| 219 | Ga0072940_1122816 | 3300005200 | Bacteria | 2618 |
| 220 | Ga0074302_1168730 | 3300005316 | Unclassified | 583 |
| 221 | Ga0466703_124494 | 3300042636 | Bacteria | 7732 |
| 222 | Ga0466703_242629 | 3300042636 | Bacteria | 92300 |
| 223 | Ga0466703_327373 | 3300042636 | Bacteria | 22986 |
| 224 | Ga0255576_1000150 | 3300026558 | Bacteria | 47989 |
| 225 | Ga0415639_001326 | 3300038395 | Bacteria | 2665 |
| 226 | Ga0415639_002004 | 3300038395 | Bacteria | 58965 |
| 227 | Ga0466693_045122 | 3300042592 | Bacteria | 1188 |
| 228 | Ga0466733_005750 | 3300042659 | Bacteria | 6291 |
| 229 | Ga0466733_130021 | 3300042659 | Unclassified | 1634 |
| 230 | Ga0466733_216041 | 3300042659 | Unclassified | 2009 |
| 231 | Ga0562379_0026 | 3300056790 | Bacteria | 801830 |
| 232 | Ga0123355_10185727 | 3300009826 | Unclassified | 3074 |
| 233 | Ga0123356_10005392 | 3300010049 | Bacteria | 13028 |
| 234 | Ga0123356_10880983 | 3300010049 | Bacteria | 1066 |
| 235 | Ga0123356_11736812 | 3300010049 | Bacteria | 775 |
| 236 | Ga0123356_11828245 | 3300010049 | Bacteria | 755 |
| 237 | Ga0123353_10005887 | 3300010167 | Bacteria | 16213 |
| 238 | Ga0123353_10013104 | 3300010167 | Bacteria | 11852 |
| 239 | Ga0123353_10322861 | 3300010167 | Unclassified | 2342 |
| 240 | Ga0123353_10503773 | 3300010167 | Bacteria | 1763 |
| 241 | Ga0123354_10022032 | 3300010882 | Bacteria | 10046 |
| 242 | Ga0466706_051212 | 3300042599 | Bacteria | 1278 |
| 243 | Ga0466706_274110 | 3300042599 | Unclassified | 1650 |
| 244 | Ga0466719_201247 | 3300042606 | Bacteria | 254275 |
| 245 | Ga0466721_062909 | 3300042608 | Bacteria | 5567 |
| 246 | Ga0466715_584084 | 3300042616 | Bacteria | 48896 |
| 247 | Ga0466726_383111 | 3300042619 | Bacteria | 1576 |
| 248 | IMNBL1DRAFT_c0001977 | 3300000062 | Bacteria | 14765 |
| 249 | IMNBL1DRAFT_c0012326 | 3300000062 | Bacteria | 3916 |
| 250 | JGI24703J35330_11425069 | 3300002501 | Bacteria | 994 |
| 251 | Ga0105553_1026687 | 3300007767 | Unclassified | 11589 |
| 252 | Ga0111037_105193 | 3300008519 | Bacteria | 11025 |
| 253 | Ga0466734_118148 | 3300042623 | Unclassified | 1147 |
| 254 | Ga0466702_204636 | 3300042635 | Unclassified | 3667 |
| 255 | Ga0466724_47707 | 3300042649 | Bacteria | 2049 |
| 256 | Ga0466725_107173 | 3300042654 | Bacteria | 1442 |
| 257 | Ga0223684_1006129 | 3300021240 | Bacteria | 2137 |
| 258 | Ga0415639_001327 | 3300038395 | Bacteria | 19043 |
| 259 | Ga0415639_012149 | 3300038395 | Bacteria | 25902 |
| 260 | Ga0415639_065900 | 3300038395 | Bacteria | 3879 |
| 261 | Ga0466657_257846 | 3300042582 | Bacteria | 1079 |
| 262 | Ga0466693_026172 | 3300042592 | Unclassified | 1747 |
| 263 | Ga0466691_054986 | 3300042593 | Bacteria | 23619 |
| 264 | Ga0466696_079590 | 3300042596 | Bacteria | 5087 |
| 265 | Ga0562376_0132 | 3300056857 | Bacteria | 164128 |
| 266 | Ga0562374_2092 | 3300057007 | Bacteria | 19473 |
| 267 | Ga0123355_10891479 | 3300009826 | Unclassified | 969 |
| 268 | Ga0123356_10112958 | 3300010049 | Bacteria | 2627 |
| 269 | Ga0123356_10159624 | 3300010049 | Unclassified | 2250 |
| 270 | Ga0123356_10609985 | 3300010049 | Bacteria | 1256 |
| 271 | Ga0123356_10742715 | 3300010049 | Unclassified | 1151 |
| 272 | Ga0123356_12032889 | 3300010049 | Bacteria | 717 |
| 273 | Ga0123353_10047514 | 3300010167 | Bacteria | 6827 |
| 274 | Ga0123353_10220916 | 3300010167 | Unclassified | 2962 |
| 275 | Ga0123353_10386684 | 3300010167 | Unclassified | 2090 |
| 276 | Ga0123353_10407714 | 3300010167 | Bacteria | 2020 |
| 277 | Ga0123353_10471232 | 3300010167 | Bacteria | 1841 |
| 278 | Ga0123353_10716353 | 3300010167 | Bacteria | 1401 |
| 279 | Ga0123353_13261776 | 3300010167 | Unclassified | 518 |
| 280 | Ga0123354_10328844 | 3300010882 | Bacteria | 1397 |
| 281 | Ga0466714_034189 | 3300042603 | Bacteria | 4534 |
| 282 | Ga0466717_149226 | 3300042604 | Bacteria | 1898 |
| 283 | Ga0466716_048178 | 3300042605 | Bacteria | 1959 |
| 284 | Ga0466721_171853 | 3300042608 | Bacteria | 2182 |
| 285 | Ga0466721_360279 | 3300042608 | Unclassified | 2601 |
| 286 | Ga0466711_249894 | 3300042615 | Bacteria | 13885 |
| 287 | Ga0466715_118504 | 3300042616 | Bacteria | 9062 |
| 288 | Ga0466726_180425 | 3300042619 | Unclassified | 1084 |
| 289 | IMNBL1DRAFT_c0002829 | 3300000062 | Bacteria | 11691 |
| 290 | JGI24702J35022_10218586 | 3300002462 | Bacteria | 1097 |
| 291 | JGI24703J35330_11735590 | 3300002501 | Bacteria | 2980 |
| 292 | JGI24703J35330_11744780 | 3300002501 | Bacteria | 4305 |
| 293 | JGI24705J35276_12199971 | 3300002504 | Unclassified | 1594 |
| 294 | Ga0068302_10003269 | 3300005071 | Bacteria | 26234 |
| 295 | Ga0072940_1055221 | 3300005200 | Bacteria | 3922 |
| 296 | Ga0072940_1122814 | 3300005200 | Bacteria | 2972 |
| 297 | Ga0065725_10013820 | 3300005283 | Unclassified | 565 |
| 298 | Ga0104147_1004950 | 3300007224 | Unclassified | 6090 |
| 299 | Ga0466734_119789 | 3300042623 | Bacteria | 17928 |
| 300 | Ga0466702_045454 | 3300042635 | Bacteria | 1982 |
| 301 | Ga0466702_125533 | 3300042635 | Bacteria | 57100 |
| 302 | Ga0466702_272368 | 3300042635 | Unclassified | 1742 |
| 303 | Ga0466704_454951 | 3300042643 | Bacteria | 4759 |
| 304 | Ga0466725_294418 | 3300042654 | Bacteria | 1295 |
| 305 | Ga0233288_1017397 | 3300022232 | Bacteria | 1650 |
| 306 | Ga0233288_1017399 | 3300022232 | Unclassified | 1351 |
| 307 | Ga0466693_280843 | 3300042592 | Unclassified | 1489 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00238 | Ribosomal_L14 | Ribosomal protein L14p/L23e | 17 | 138 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.