Protein Family IF03258
Metagenome
Isolate
138
Members
55
Samples
133
Scaffolds
391.49
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10347445|Ga0123353_103474451
- Length
- 428 aa
- Sequence
- MLFAKNIFCVFLLFIXXIFVSLPAEKGKEMEELFDIFYRELRKTDLSFQRYLADDIHWEGRLSAITGARGAGKTTMMMQHIKKTFGNSPKEVLYVSLDNIWFSGNRLYDLANDFEKQGGKYLFIDEVHKYENWSQEIKNIYDSFNDLKVVFTGSSMLEIYRGNADLSRRAVHYILQGMSFREFLKFDQNIEFEKFTLEDILQNHTEIASAVNEKIRPLPLFDTYIKQGYYPYYKSDNRFYLSKLANTVNLILETDLPAIETIEMYSIRKIKKLLWIISQSVPFTPKITDLAANLGVSRNSLLNYLTILERGGLINLLQSNTKGVKSLAKPEKIYLNNTNLIYAFDSNKPNIGNLRETFFCNQLKAVSEVTSANKADFTINSEYVFEVGGKNKGHEQITGLDNAYLALDHLEYGFGNKIPLWLFGMLY*
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.7%
Kalotermitidae
18.5%
Unclassified
13.0%
Termopsidae
3.7%
Passalidae
3.7%
Hodotermitidae
1.9%
Rhinotermitidae
1.9%
Culicidae
1.9%
Kiwaidae
1.9%
Taxonomy
Archaea
0
Bacteria
127
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2820651690 | Unclassified Firmicutes Cu122P3bin6 | Isolate | Unclassified |
| 10 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 19 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 27 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 28 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 39 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 40 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 41 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 42 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 43 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 52 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 53 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 54 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 55 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0157631_100162 | 3300013007 | Bacteria | 9475 |
| 2 | Ga0157631_102480 | 3300013007 | Bacteria | 5129 |
| 3 | Ga0466690_206304 | 3300042590 | Bacteria | 14937 |
| 4 | Ga0466693_277639 | 3300042592 | Bacteria | 1688 |
| 5 | Ga0466691_042318 | 3300042593 | Bacteria | 15912 |
| 6 | Ga0466699_390827 | 3300042597 | Bacteria | 1925 |
| 7 | IMNBL1DRAFT_c0044515 | 3300000062 | Bacteria | 1458 |
| 8 | Ga0105524_107740 | 3300007733 | Bacteria | 1414 |
| 9 | Ga0123357_10006137 | 3300009784 | Bacteria | 14565 |
| 10 | Ga0123355_10248332 | 3300009826 | Bacteria | 2510 |
| 11 | Ga0123356_10136441 | 3300010049 | Bacteria | 2412 |
| 12 | Ga0123353_10015072 | 3300010167 | Bacteria | 11199 |
| 13 | Ga0123353_10110159 | 3300010167 | Bacteria | 4436 |
| 14 | Ga0123353_10126538 | 3300010167 | Bacteria | 4106 |
| 15 | Ga0123354_10097095 | 3300010882 | Bacteria | 4018 |
| 16 | Ga0123354_10159089 | 3300010882 | Bacteria | 2692 |
| 17 | Ga0123354_10204657 | 3300010882 | Unclassified | 2156 |
| 18 | Ga0466719_480152 | 3300042606 | Bacteria | 2483 |
| 19 | Ga0466719_576802 | 3300042606 | Bacteria | 3474 |
| 20 | Ga0466722_033284 | 3300042609 | Bacteria | 7519 |
| 21 | Ga0466735_099948 | 3300042624 | Bacteria | 1538 |
| 22 | Ga0466715_048583 | 3300042616 | Bacteria | 3566 |
| 23 | Ga0466728_020012 | 3300042620 | Bacteria | 18591 |
| 24 | Ga0466705_226303 | 3300042612 | Bacteria | 21197 |
| 25 | JGI24702J35022_10019955 | 3300002462 | Bacteria | 3643 |
| 26 | JGI24702J35022_10046542 | 3300002462 | Bacteria | 2310 |
| 27 | JGI24702J35022_10080861 | 3300002462 | Bacteria | 1760 |
| 28 | Ga0123357_10032829 | 3300009784 | Bacteria | 7051 |
| 29 | Ga0123357_10032876 | 3300009784 | Bacteria | 7046 |
| 30 | Ga0123356_10379306 | 3300010049 | Bacteria | 1546 |
| 31 | Ga0123353_10200843 | 3300010167 | Bacteria | 3137 |
| 32 | Ga0123354_10209507 | 3300010882 | Bacteria | 2112 |
| 33 | Ga0466707_262428 | 3300042601 | Bacteria | 12401 |
| 34 | Ga0466714_093285 | 3300042603 | Bacteria | 105352 |
| 35 | Ga0466719_333138 | 3300042606 | Bacteria | 18795 |
| 36 | Ga0466721_253481 | 3300042608 | Bacteria | 27977 |
| 37 | Ga0466698_468474 | 3300042610 | Bacteria | 1821 |
| 38 | Ga0466704_347575 | 3300042643 | Unclassified | 2202 |
| 39 | Ga0466710_343674 | 3300042613 | Bacteria | 3706 |
| 40 | Ga0466715_186831 | 3300042616 | Bacteria | 8143 |
| 41 | Ga0466715_505413 | 3300042616 | Bacteria | 29515 |
| 42 | Ga0466732_128756 | 3300042656 | Bacteria | 2820 |
| 43 | JGI24702J35022_10080637 | 3300002462 | Bacteria | 1763 |
| 44 | Ga0123353_10347445 | 3300010167 | Bacteria | 2237 |
| 45 | Ga0123354_10082160 | 3300010882 | Bacteria | 4544 |
| 46 | Ga0466706_086847 | 3300042599 | Bacteria | 7914 |
| 47 | Ga0466713_006627 | 3300042602 | Bacteria | 53257 |
| 48 | Ga0466719_337035 | 3300042606 | Bacteria | 1757 |
| 49 | Ga0466719_376002 | 3300042606 | Bacteria | 2619 |
| 50 | Ga0466719_434555 | 3300042606 | Bacteria | 1275 |
| 51 | Ga0466657_173015 | 3300042582 | Bacteria | 9381 |
| 52 | Ga0466694_242559 | 3300042594 | Bacteria | 2486 |
| 53 | JGI24696J40584_12924479 | 3300002834 | Bacteria | 1388 |
| 54 | Ga0123356_10014528 | 3300010049 | Bacteria | 7568 |
| 55 | Ga0123356_10105083 | 3300010049 | Bacteria | 2716 |
| 56 | Ga0123356_10297415 | 3300010049 | Bacteria | 1718 |
| 57 | Ga0123353_10023940 | 3300010167 | Bacteria | 9256 |
| 58 | Ga0123353_10797423 | 3300010167 | Bacteria | 1305 |
| 59 | Ga0123354_10142615 | 3300010882 | Bacteria | 2953 |
| 60 | Ga0123354_10281276 | 3300010882 | Bacteria | 1615 |
| 61 | Ga0466719_497506 | 3300042606 | Bacteria | 1366 |
| 62 | Ga0466719_503602 | 3300042606 | Bacteria | 5419 |
| 63 | Ga0466731_123080 | 3300042622 | Bacteria | 1585 |
| 64 | Ga0466725_383347 | 3300042654 | Bacteria | 1906 |
| 65 | Ga0466705_519506 | 3300042612 | Bacteria | 1609 |
| 66 | Ga0466715_132880 | 3300042616 | Bacteria | 7151 |
| 67 | Ga0466697_119100 | 3300042611 | Bacteria | 2336 |
| 68 | Ga0466705_095643 | 3300042612 | Bacteria | 15336 |
| 69 | Ga0466656_049425 | 3300042550 | Bacteria | 1890 |
| 70 | Ga0466701_009514 | 3300042598 | Bacteria | 17288 |
| 71 | Ga0123357_10002496 | 3300009784 | Bacteria | 20568 |
| 72 | Ga0123357_10084206 | 3300009784 | Bacteria | 4169 |
| 73 | Ga0123354_10256689 | 3300010882 | Bacteria | 1756 |
| 74 | Ga0123354_10291908 | 3300010882 | Bacteria | 1561 |
| 75 | Ga0123354_10297776 | 3300010882 | Bacteria | 1532 |
| 76 | Ga0466700_368270 | 3300042600 | Bacteria | 7465 |
| 77 | Ga0466716_464898 | 3300042605 | Bacteria | 1830 |
| 78 | Ga0466719_114278 | 3300042606 | Bacteria | 3052 |
| 79 | Ga0466722_242029 | 3300042609 | Bacteria | 1796 |
| 80 | Ga0466731_004209 | 3300042622 | Bacteria | 1762 |
| 81 | Ga0466702_269660 | 3300042635 | Bacteria | 3124 |
| 82 | Ga0466725_034760 | 3300042654 | Bacteria | 13871 |
| 83 | Ga0466725_364489 | 3300042654 | Bacteria | 1586 |
| 84 | Ga0466728_318794 | 3300042620 | Bacteria | 15039 |
| 85 | Ga0466705_040046 | 3300042612 | Bacteria | 4639 |
| 86 | Ga0466733_146065 | 3300042659 | Bacteria | 12551 |
| 87 | Ga0466694_409062 | 3300042594 | Bacteria | 1761 |
| 88 | Ga0466695_271029 | 3300042595 | Bacteria | 2305 |
| 89 | Ga0466696_225783 | 3300042596 | Bacteria | 3325 |
| 90 | 2227085283 | 2225789004 | Unclassified | 1858 |
| 91 | IMNBL1DRAFT_c0006495 | 3300000062 | Unclassified | 6377 |
| 92 | JGI24702J35022_10121701 | 3300002462 | Unclassified | 1442 |
| 93 | JGI24705J35276_12180997 | 3300002504 | Bacteria | 1368 |
| 94 | JGI24696J40584_12956850 | 3300002834 | Unclassified | 3260 |
| 95 | Ga0123354_10097514 | 3300010882 | Unclassified | 4005 |
| 96 | Ga0466714_138519 | 3300042603 | Bacteria | 1652 |
| 97 | Ga0466717_193628 | 3300042604 | Bacteria | 1737 |
| 98 | Ga0466717_301807 | 3300042604 | Bacteria | 1456 |
| 99 | Ga0466705_289902 | 3300042612 | Bacteria | 1688 |
| 100 | Ga0160470_100980 | 3300012813 | Bacteria | 8007 |
| 101 | Ga0466693_303615 | 3300042592 | Unclassified | 1201 |
| 102 | Ga0466694_043198 | 3300042594 | Bacteria | 21278 |
| 103 | IMNBL1DRAFT_c0008998 | 3300000062 | Bacteria | 5010 |
| 104 | IMNBL1DRAFT_c0031965 | 3300000062 | Bacteria | 1905 |
| 105 | JGI24698J34947_10072906 | 3300002449 | Unclassified | 1641 |
| 106 | JGI24705J35276_12213540 | 3300002504 | Bacteria | 1927 |
| 107 | Ga0105524_103240 | 3300007733 | Bacteria | 4167 |
| 108 | Ga0123355_10035664 | 3300009826 | Bacteria | 8084 |
| 109 | Ga0466701_060515 | 3300042598 | Bacteria | 1573 |
| 110 | Ga0466706_138012 | 3300042599 | Bacteria | 43154 |
| 111 | Ga0466707_246433 | 3300042601 | Bacteria | 13329 |
| 112 | Ga0466735_144679 | 3300042624 | Bacteria | 2680 |
| 113 | Ga0466724_37797 | 3300042649 | Bacteria | 1816 |
| 114 | Ga0466711_405984 | 3300042615 | Bacteria | 18483 |
| 115 | Ga0466715_115556 | 3300042616 | Bacteria | 10345 |
| 116 | Ga0466715_324184 | 3300042616 | Bacteria | 11897 |
| 117 | Ga0157631_144729 | 3300013007 | Bacteria | 3745 |
| 118 | Ga0466690_199492 | 3300042590 | Bacteria | 1500 |
| 119 | Ga0466696_328519 | 3300042596 | Bacteria | 2068 |
| 120 | IMNBL1DRAFT_c0013095 | 3300000062 | Bacteria | 3747 |
| 121 | JGI24702J35022_10083617 | 3300002462 | Bacteria | 1731 |
| 122 | Ga0123357_10033968 | 3300009784 | Bacteria | 6931 |
| 123 | Ga0123357_10196115 | 3300009784 | Bacteria | 2312 |
| 124 | Ga0123356_10003096 | 3300010049 | Bacteria | 17564 |
| 125 | Ga0123353_10501579 | 3300010167 | Bacteria | 1768 |
| 126 | Ga0466701_035303 | 3300042598 | Bacteria | 1940 |
| 127 | Ga0466706_225636 | 3300042599 | Unclassified | 2770 |
| 128 | Ga0466722_004757 | 3300042609 | Bacteria | 3044 |
| 129 | Ga0466731_131898 | 3300042622 | Bacteria | 3385 |
| 130 | Ga0466731_407570 | 3300042622 | Unclassified | 1614 |
| 131 | Ga0466735_225168 | 3300042624 | Bacteria | 2006 |
| 132 | Ga0466727_166293 | 3300042655 | Bacteria | 7612 |
| 133 | Ga0466705_517820 | 3300042612 | Bacteria | 1530 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.