Protein Family IF03246
Metagenome
Metatranscriptome
Isolate
161
Members
68
Samples
143
Scaffolds
119.7
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10315632|Ga0123353_103156323
- Length
- 132 aa
- Sequence
- MSRAVDGSKRKNHRKKILKLAKGYWGRRSTNYKTAKDAVAKALTYAYRDRKDRKGDFRSLWIIRINAACREEGISYSRLIDGLNKAGITINRKALSSLAISDPNAFKAVVAQAKAALEKTAGPKGQKSESA*
Sample Types
Isolate
11.2%
Metagenome
87.0%
MAG
0.0%
Metatranscriptome
1.9%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.3%
Unclassified
28.1%
Kalotermitidae
17.2%
Termopsidae
4.7%
Passalidae
1.6%
Hodotermitidae
1.6%
Rhinotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
131
Eukaryota
0
Viruses
0
Unclassified
30
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 10 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 15 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 16 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 19 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 20 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 21 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 22 | 2778260937 | Unclassified Fibrobacteres Co191P3bin40 | Isolate | Unclassified |
| 23 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 38 | 2778260939 | Unclassified Fibrobacteres Co191P4bin13 | Isolate | Unclassified |
| 39 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 40 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 41 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 44 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 46 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 47 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 48 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 49 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 50 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 51 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 52 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 53 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 54 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 55 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 56 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 57 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 58 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 61 | 2773857779 | Unclassified Fibrobacteres Co191P1bin69 | Isolate | Unclassified |
| 62 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 63 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 64 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 65 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 66 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 67 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 68 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_031230 | 3300042612 | Bacteria | 6977 |
| 2 | Ga0466705_187250 | 3300042612 | Bacteria | 6494 |
| 3 | Ga0123357_10421060 | 3300009784 | Bacteria | 1191 |
| 4 | Ga0123356_11367766 | 3300010049 | Bacteria | 869 |
| 5 | Ga0123353_11473311 | 3300010167 | Bacteria | 869 |
| 6 | Ga0466706_043276 | 3300042599 | Bacteria | 7419 |
| 7 | Ga0466700_026449 | 3300042600 | Bacteria | 1620 |
| 8 | Ga0466707_395953 | 3300042601 | Bacteria | 1061 |
| 9 | Ga0466714_113515 | 3300042603 | Bacteria | 4652 |
| 10 | Ga0466690_109429 | 3300042590 | Bacteria | 13826 |
| 11 | Ga0466694_054118 | 3300042594 | Bacteria | 2684 |
| 12 | Ga0466694_239236 | 3300042594 | Bacteria | 3934 |
| 13 | Ga0466696_244546 | 3300042596 | Unclassified | 1521 |
| 14 | Ga0466699_064951 | 3300042597 | Bacteria | 2061 |
| 15 | Ga0466699_070182 | 3300042597 | Unclassified | 1518 |
| 16 | Ga0466703_226676 | 3300042636 | Bacteria | 16226 |
| 17 | Ga0466708_412465 | 3300042652 | Bacteria | 1825 |
| 18 | Ga0466705_460580 | 3300042612 | Bacteria | 18473 |
| 19 | Ga0466712_263480 | 3300042614 | Bacteria | 1130 |
| 20 | JGI24698J34947_10037601 | 3300002449 | Bacteria | 2514 |
| 21 | JGI24698J34947_10184991 | 3300002449 | Unclassified | 829 |
| 22 | Ga0072941_1001366 | 3300005201 | Bacteria | 47812 |
| 23 | Ga0123355_10007691 | 3300009826 | Bacteria | 16192 |
| 24 | Ga0123356_13687923 | 3300010049 | Bacteria | 530 |
| 25 | Ga0466717_223095 | 3300042604 | Bacteria | 1138 |
| 26 | Ga0466698_264407 | 3300042610 | Bacteria | 1389 |
| 27 | Ga0223674_1009236 | 3300021235 | Bacteria | 849 |
| 28 | Ga0233288_1046642 | 3300022232 | Bacteria | 621 |
| 29 | Ga0466690_420697 | 3300042590 | Bacteria | 2388 |
| 30 | Ga0466694_049035 | 3300042594 | Bacteria | 10888 |
| 31 | Ga0466696_164169 | 3300042596 | Bacteria | 1049 |
| 32 | Ga0466704_388066 | 3300042643 | Unclassified | 2652 |
| 33 | Ga0466718_002704 | 3300042617 | Unclassified | 1146 |
| 34 | Nasutiter_Contig43200 | 2030936001 | Bacteria | 886 |
| 35 | AustNasuHG_c1010870 | 3300000089 | Bacteria | 3162 |
| 36 | JGI24698J34947_10011345 | 3300002449 | Bacteria | 4893 |
| 37 | Ga0072941_1004105 | 3300005201 | Bacteria | 66249 |
| 38 | Ga0466732_212815 | 3300042656 | Unclassified | 2532 |
| 39 | Ga0123356_10438116 | 3300010049 | Bacteria | 1452 |
| 40 | Ga0123353_10007636 | 3300010167 | Bacteria | 14654 |
| 41 | Ga0466717_281128 | 3300042604 | Bacteria | 1399 |
| 42 | Ga0466698_312232 | 3300042610 | Bacteria | 1342 |
| 43 | Ga0466690_049966 | 3300042590 | Unclassified | 1252 |
| 44 | Ga0466691_167565 | 3300042593 | Bacteria | 12185 |
| 45 | Ga0466691_208255 | 3300042593 | Bacteria | 7145 |
| 46 | Ga0466702_325726 | 3300042635 | Bacteria | 1145 |
| 47 | Ga0466704_379221 | 3300042643 | Bacteria | 70022 |
| 48 | Ga0466704_550851 | 3300042643 | Bacteria | 33976 |
| 49 | Ga0466727_124291 | 3300042655 | Bacteria | 1719 |
| 50 | Ga0466712_056047 | 3300042614 | Bacteria | 48418 |
| 51 | Ga0466712_056342 | 3300042614 | Bacteria | 1251 |
| 52 | Ga0466715_395182 | 3300042616 | Bacteria | 10277 |
| 53 | Ga0466715_534972 | 3300042616 | Bacteria | 7927 |
| 54 | Ga0466718_122140 | 3300042617 | Unclassified | 4246 |
| 55 | Ga0466718_142902 | 3300042617 | Bacteria | 1490 |
| 56 | Ga0466723_116455 | 3300042618 | Bacteria | 47618 |
| 57 | Ga0466726_260426 | 3300042619 | Bacteria | 1929 |
| 58 | AustNasuHG_c1051836 | 3300000089 | Unclassified | 869 |
| 59 | JGI24698J34947_10067465 | 3300002449 | Bacteria | 1736 |
| 60 | JGI24695J34938_10046196 | 3300002450 | Bacteria | 1928 |
| 61 | JGI24696J40584_12959629 | 3300002834 | Unclassified | 5399 |
| 62 | Ga0074263_113670 | 3300005485 | Bacteria | 2040 |
| 63 | Ga0466705_221228 | 3300042612 | Bacteria | 6333 |
| 64 | Ga0123356_10008251 | 3300010049 | Bacteria | 10364 |
| 65 | Ga0123356_12074220 | 3300010049 | Bacteria | 710 |
| 66 | Ga0123356_13913496 | 3300010049 | Unclassified | 514 |
| 67 | Ga0123353_10315632 | 3300010167 | Bacteria | 2375 |
| 68 | Ga0123353_13097291 | 3300010167 | Bacteria | 536 |
| 69 | Ga0466700_307496 | 3300042600 | Bacteria | 1532 |
| 70 | Ga0466720_069142 | 3300042607 | Bacteria | 1453 |
| 71 | Ga0255786_1000885 | 3300022815 | Bacteria | 2692 |
| 72 | Ga0264413_103525 | 3300024493 | Bacteria | 1423 |
| 73 | Ga0466690_263800 | 3300042590 | Bacteria | 17176 |
| 74 | Ga0466691_082426 | 3300042593 | Bacteria | 11158 |
| 75 | Ga0466694_010494 | 3300042594 | Bacteria | 4613 |
| 76 | Ga0466696_129657 | 3300042596 | Bacteria | 12080 |
| 77 | Ga0466702_274221 | 3300042635 | Bacteria | 1814 |
| 78 | IMNBGM34_c001079 | 3300000036 | Bacteria | 5395 |
| 79 | JGI24695J34938_10243509 | 3300002450 | Bacteria | 761 |
| 80 | JGI24697J35500_11097157 | 3300002507 | Bacteria | 1156 |
| 81 | Ga0466705_245395 | 3300042612 | Bacteria | 1276 |
| 82 | Ga0466719_128746 | 3300042606 | Bacteria | 9047 |
| 83 | Ga0466698_242437 | 3300042610 | Bacteria | 1710 |
| 84 | Ga0415639_002732 | 3300038395 | Bacteria | 2276 |
| 85 | Ga0466690_004645 | 3300042590 | Unclassified | 1304 |
| 86 | Ga0466694_032775 | 3300042594 | Bacteria | 13600 |
| 87 | Ga0466735_020673 | 3300042624 | Unclassified | 1951 |
| 88 | Ga0466712_068659 | 3300042614 | Bacteria | 15970 |
| 89 | Ga0466718_038899 | 3300042617 | Bacteria | 2239 |
| 90 | Ga0466718_039462 | 3300042617 | Bacteria | 2624 |
| 91 | FAAS_10000063 | 3300001880 | Unclassified | 1154 |
| 92 | JGI24698J34947_10025907 | 3300002449 | Unclassified | 3118 |
| 93 | JGI24698J34947_10042613 | 3300002449 | Unclassified | 2331 |
| 94 | JGI24695J34938_10014289 | 3300002450 | Unclassified | 4123 |
| 95 | Ga0123356_12505169 | 3300010049 | Unclassified | 646 |
| 96 | Ga0123354_10638768 | 3300010882 | Bacteria | 765 |
| 97 | Ga0466706_075371 | 3300042599 | Bacteria | 2626 |
| 98 | Ga0466719_441370 | 3300042606 | Bacteria | 11629 |
| 99 | Ga0466720_051720 | 3300042607 | Bacteria | 1879 |
| 100 | Ga0466690_128251 | 3300042590 | Bacteria | 1959 |
| 101 | Ga0466691_030135 | 3300042593 | Bacteria | 5145 |
| 102 | Ga0466694_026381 | 3300042594 | Unclassified | 4079 |
| 103 | Ga0466694_305287 | 3300042594 | Bacteria | 3269 |
| 104 | Ga0466731_115071 | 3300042622 | Bacteria | 15936 |
| 105 | Ga0466704_031411 | 3300042643 | Bacteria | 8671 |
| 106 | Ga0466704_233397 | 3300042643 | Bacteria | 6669 |
| 107 | Ga0466712_174768 | 3300042614 | Unclassified | 3228 |
| 108 | Ga0466715_250245 | 3300042616 | Bacteria | 3118 |
| 109 | Ga0466726_458039 | 3300042619 | Bacteria | 3578 |
| 110 | JGI24698J34947_10061846 | 3300002449 | Unclassified | 1840 |
| 111 | Ga0466705_338949 | 3300042612 | Unclassified | 1761 |
| 112 | Ga0466732_247783 | 3300042656 | Unclassified | 3117 |
| 113 | Ga0123357_10489509 | 3300009784 | Bacteria | 1031 |
| 114 | Ga0123355_10158258 | 3300009826 | Bacteria | 3420 |
| 115 | Ga0123353_11071921 | 3300010167 | Unclassified | 1074 |
| 116 | Ga0466720_031933 | 3300042607 | Unclassified | 1559 |
| 117 | Ga0466690_036413 | 3300042590 | Bacteria | 2787 |
| 118 | Ga0466694_271333 | 3300042594 | Bacteria | 14159 |
| 119 | Ga0466696_210318 | 3300042596 | Bacteria | 1762 |
| 120 | Ga0466696_213050 | 3300042596 | Bacteria | 28304 |
| 121 | Ga0466696_235321 | 3300042596 | Bacteria | 8711 |
| 122 | Ga0466703_251204 | 3300042636 | Unclassified | 1950 |
| 123 | Ga0466709_257902 | 3300042648 | Bacteria | 5857 |
| 124 | Ga0466705_457726 | 3300042612 | Bacteria | 9162 |
| 125 | Ga0466718_027993 | 3300042617 | Bacteria | 7550 |
| 126 | Ga0466723_078908 | 3300042618 | Bacteria | 2041 |
| 127 | Ga0466723_343537 | 3300042618 | Bacteria | 96271 |
| 128 | JGI24698J34947_10021787 | 3300002449 | Unclassified | 3443 |
| 129 | JGI24698J34947_10061293 | 3300002449 | Unclassified | 1852 |
| 130 | JGI24702J35022_10011256 | 3300002462 | Bacteria | 4987 |
| 131 | JGI24702J35022_10153530 | 3300002462 | Bacteria | 1293 |
| 132 | Ga0072940_1123849 | 3300005200 | Bacteria | 841 |
| 133 | Ga0072941_1013427 | 3300005201 | Bacteria | 25633 |
| 134 | Ga0123355_10379957 | 3300009826 | Bacteria | 1842 |
| 135 | Ga0123356_11189605 | 3300010049 | Bacteria | 929 |
| 136 | Ga0123356_12265476 | 3300010049 | Bacteria | 679 |
| 137 | Ga0466720_049913 | 3300042607 | Unclassified | 1284 |
| 138 | Ga0466698_287763 | 3300042610 | Bacteria | 3879 |
| 139 | Ga0264413_100848 | 3300024493 | Bacteria | 12180 |
| 140 | Ga0466694_404462 | 3300042594 | Bacteria | 1002 |
| 141 | Ga0466712_097628 | 3300042614 | Unclassified | 8115 |
| 142 | Ga0466715_226168 | 3300042616 | Bacteria | 12316 |
| 143 | Ga0466718_022973 | 3300042617 | Bacteria | 6324 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00453 | Ribosomal_L20 | Ribosomal protein L20 | 3 | 108 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.