Protein Family IF03202

Metagenome Isolate
254 Members
85 Samples
215 Scaffolds
265.33 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10217393|Ga0123353_102173932
Length
285 aa
Sequence
VLDKDSYSVTVWGNDTVLFEKKRGMMTVMSDIEAIRSKQGYLCDMDGVIYHGNRILEGAWDFVTWLEESGKSYLFLTNASSPTPTDLKNKLARMGLDIDESKFYTSALATAKFLHNQSPGCSAYVIGDSGLVIALNDDVDPDYVVVGETCSYDYEKITKAIDFVMNGAKLIGAHPDMTSPSEEGLIPACRALIAPIELAAERSAYYIGKPNALMMRTGLSMLGVHSSEAAIIGDRMDTDIIAGIETGLETVLVLSGVTSREQVKLFPYRPKYILNNVGEIVISS*

πŸ“Š Sample Types

Isolate 15.3%
Metagenome 84.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 32.9%
Termitidae 27.1%
Kalotermitidae 16.5%
Formicidae 8.2%
Rhinotermitidae 4.7%
Termopsidae 2.4%
Passalidae 2.4%
Tenebrionidae 1.2%
Hodotermitidae 1.2%
Scarabaeidae 1.2%
Cimicidae 1.2%
Pentatomidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 241
Eukaryota 0
Viruses 0
Unclassified 13

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
2 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
5 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
16 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
17 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
18 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
19 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
20 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
21 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
22 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
23 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
28 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
29 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
30 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
31 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
32 2820412446 Unclassified Firmicutes Lab288P4bin39 Isolate Unclassified
33 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
34 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
35 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
41 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
42 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
43 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
44 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
45 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
50 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
51 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
52 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
53 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
54 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
55 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
56 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
57 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
58 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
59 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
60 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
61 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
62 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
63 2819999932 Unclassified Synergistetes Th196P4bin51 Isolate Unclassified
64 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
65 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
66 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
67 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
68 8073544309 Actinomadura sp. RB99 Isolate Termitidae
69 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
70 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
71 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
72 2820931684 Unclassified Actinobacteria Emb289P1bin89 Isolate Unclassified
73 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
74 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
75 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
76 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
77 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
78 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
79 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
80 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
81 2820924633 Unclassified Actinobacteria Emb289P3bin142 Isolate Unclassified
82 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
83 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
84 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
85 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_110183 3300042612 Bacteria 12602
2 Ga0562376_0311 3300056857 Bacteria 95811
3 Ga0466710_138700 3300042613 Bacteria 2709
4 Ga0466715_010642 3300042616 Bacteria 9264
5 Ga0466723_024030 3300042618 Bacteria 1919
6 Ga0466723_068921 3300042618 Bacteria 1665
7 Ga0466726_329052 3300042619 Unclassified 2386
8 Ga0466728_406006 3300042620 Bacteria 2842
9 Ga0415639_115142 3300038395 Bacteria 8614
10 Ga0466692_058765 3300042591 Bacteria 30559
11 Ga0466696_483230 3300042596 Bacteria 2611
12 Ga0466699_234316 3300042597 Bacteria 2724
13 Ga0466699_283212 3300042597 Bacteria 1088
14 Ga0466699_316695 3300042597 Bacteria 7985
15 Ga0123355_10076018 3300009826 Bacteria 5373
16 Ga0123356_10001785 3300010049 Bacteria 23465
17 Ga0123353_10003046 3300010167 Bacteria 20988
18 Ga0123353_10192746 3300010167 Bacteria 3215
19 Ga0123353_10444597 3300010167 Bacteria 1911
20 Ga0466703_300871 3300042636 Bacteria 15230
21 Ga0466704_441494 3300042643 Bacteria 4903
22 Ga0466709_078685 3300042648 Bacteria 5023
23 Ga0466727_256006 3300042655 Bacteria 2692
24 2227619075 2225789004 Unclassified 11842
25 IMNBL1DRAFT_c0047541 3300000062 Bacteria 1384
26 JGI24702J35022_10023882 3300002462 Unclassified 3304
27 JGI24702J35022_10355629 3300002462 Bacteria 876
28 Ga0466700_014821 3300042600 Bacteria 1604
29 Ga0466707_346372 3300042601 Bacteria 1447
30 Ga0466707_365807 3300042601 Bacteria 2591
31 Ga0466707_396159 3300042601 Bacteria 1546
32 Ga0466719_016189 3300042606 Bacteria 5219
33 Ga0466719_022377 3300042606 Bacteria 5362
34 Ga0466719_150059 3300042606 Bacteria 20768
35 Ga0466719_225246 3300042606 Bacteria 3384
36 Ga0466722_072461 3300042609 Bacteria 12361
37 Ga0466705_050542 3300042612 Bacteria 9653
38 Ga0466712_074297 3300042614 Bacteria 1899
39 Ga0466711_166710 3300042615 Bacteria 26303
40 Ga0466715_061123 3300042616 Bacteria 10345
41 Ga0466723_082532 3300042618 Bacteria 11610
42 Ga0466726_321135 3300042619 Bacteria 5018
43 Ga0466726_420642 3300042619 Bacteria 3225
44 Ga0466728_254100 3300042620 Bacteria 1311
45 Ga0466728_254297 3300042620 Unclassified 4434
46 Ga0466690_279543 3300042590 Bacteria 4422
47 Ga0466692_008596 3300042591 Unclassified 5079
48 Ga0466692_187572 3300042591 Bacteria 21965
49 Ga0466691_145985 3300042593 Bacteria 16856
50 Ga0466699_424769 3300042597 Bacteria 1340
51 Ga0123356_10010303 3300010049 Bacteria 9181
52 Ga0123356_10298876 3300010049 Bacteria 1714
53 Ga0123356_10309493 3300010049 Bacteria 1688
54 Ga0123356_10413964 3300010049 Bacteria 1488
55 Ga0123356_10863436 3300010049 Bacteria 1076
56 Ga0123353_10235363 3300010167 Bacteria 2851
57 Ga0123354_10100404 3300010882 Bacteria 3917
58 Ga0466703_012892 3300042636 Bacteria 3571
59 Ga0466709_170433 3300042648 Bacteria 14693
60 2227536063 2225789004 Bacteria 3066
61 Ga0123357_10000374 3300009784 Bacteria 42320
62 Ga0466700_105706 3300042600 Bacteria 1457
63 Ga0466700_390800 3300042600 Bacteria 2438
64 Ga0466716_129079 3300042605 Bacteria 2827
65 Ga0466722_085250 3300042609 Bacteria 11239
66 Ga0466722_261341 3300042609 Bacteria 2203
67 Ga0466698_001196 3300042610 Bacteria 1411
68 Ga0466705_126394 3300042612 Bacteria 14291
69 Ga0466733_172465 3300042659 Bacteria 2100
70 Ga0466705_471867 3300042612 Bacteria 10275
71 Ga0466711_074425 3300042615 Bacteria 2639
72 Ga0466711_499263 3300042615 Bacteria 6008
73 Ga0466715_347325 3300042616 Bacteria 3206
74 Ga0466726_108932 3300042619 Bacteria 1969
75 Ga0466728_011483 3300042620 Bacteria 2428
76 Ga0466729_124248 3300042621 Bacteria 1372
77 Ga0466690_149414 3300042590 Bacteria 15159
78 Ga0466692_015656 3300042591 Bacteria 13711
79 Ga0466696_367695 3300042596 Bacteria 6269
80 Ga0466699_361450 3300042597 Unclassified 1029
81 Ga0123355_10090805 3300009826 Bacteria 4844
82 Ga0123355_10231170 3300009826 Bacteria 2640
83 Ga0123356_10050811 3300010049 Bacteria 3857
84 Ga0123356_10725654 3300010049 Bacteria 1163
85 Ga0123356_10945048 3300010049 Bacteria 1033
86 Ga0123353_10374631 3300010167 Bacteria 2132
87 Ga0466704_268396 3300042643 Bacteria 2542
88 Ga0466704_505608 3300042643 Bacteria 19210
89 Ga0466708_220977 3300042652 Bacteria 2802
90 Ga0466727_166421 3300042655 Bacteria 2395
91 IMNBL1DRAFT_c0000228 3300000062 Bacteria 49223
92 IMNBL1DRAFT_c0004015 3300000062 Bacteria 9059
93 Ga0466706_154583 3300042599 Unclassified 2608
94 Ga0466706_240415 3300042599 Unclassified 4384
95 Ga0466714_052671 3300042603 Bacteria 2761
96 Ga0466698_396459 3300042610 Bacteria 2505
97 Ga0466697_101231 3300042611 Bacteria 2031
98 Ga0466733_217158 3300042659 Bacteria 7604
99 Ga0466712_015286 3300042614 Bacteria 15756
100 Ga0466712_170606 3300042614 Bacteria 45022
101 Ga0466711_152736 3300042615 Bacteria 27966
102 Ga0466728_204104 3300042620 Bacteria 4518
103 Ga0456237_0004756 3300041968 Unclassified 2174
104 Ga0466691_051458 3300042593 Bacteria 13212
105 Ga0466696_232064 3300042596 Bacteria 6109
106 Ga0466696_282647 3300042596 Bacteria 3558
107 Ga0123355_10040352 3300009826 Bacteria 7596
108 Ga0123355_10058881 3300009826 Bacteria 6212
109 Ga0123356_10010537 3300010049 Bacteria 9065
110 Ga0123356_10216177 3300010049 Bacteria 1970
111 Ga0123353_10043491 3300010167 Bacteria 7116
112 Ga0123353_10217393 3300010167 Bacteria 2992
113 Ga0466703_309847 3300042636 Bacteria 4994
114 Ga0466708_109293 3300042652 Bacteria 9912
115 Ga0466708_266879 3300042652 Bacteria 7667
116 Ga0466708_295631 3300042652 Bacteria 6461
117 IMNBL1DRAFT_c0000240 3300000062 Bacteria 48221
118 IMNBL1DRAFT_c0028905 3300000062 Bacteria 2059
119 JGI24702J35022_10065038 3300002462 Bacteria 1956
120 Ga0466700_427196 3300042600 Bacteria 1614
121 Ga0466714_085163 3300042603 Bacteria 1108
122 Ga0466722_222999 3300042609 Bacteria 2750
123 Ga0466705_344698 3300042612 Bacteria 1122
124 Ga0466711_099157 3300042615 Bacteria 2267
125 Ga0466715_346322 3300042616 Bacteria 84028
126 Ga0466728_028747 3300042620 Bacteria 6061
127 Ga0466691_102405 3300042593 Bacteria 18269
128 Ga0466696_289999 3300042596 Bacteria 4604
129 Ga0466699_076159 3300042597 Bacteria 2041
130 Ga0466699_253007 3300042597 Bacteria 2116
131 Ga0466703_371449 3300042636 Bacteria 1672
132 Ga0466704_034160 3300042643 Bacteria 21086
133 Ga0466727_336836 3300042655 Bacteria 1580
134 JGI24696J40584_12961432 3300002834 Bacteria 15972
135 Ga0466701_043122 3300042598 Bacteria 3936
136 Ga0466700_142401 3300042600 Bacteria 1826
137 Ga0466707_163303 3300042601 Bacteria 4189
138 Ga0466714_099424 3300042603 Bacteria 1266
139 Ga0466719_149701 3300042606 Bacteria 5785
140 Ga0466722_161547 3300042609 Bacteria 1250
141 Ga0466722_213201 3300042609 Bacteria 1485
142 Ga0466705_139824 3300042612 Bacteria 61712
143 Ga0466705_243763 3300042612 Unclassified 2772
144 Ga0466710_175991 3300042613 Bacteria 1095
145 Ga0466711_259424 3300042615 Bacteria 2117
146 Ga0466723_064185 3300042618 Bacteria 19759
147 Ga0466728_164939 3300042620 Bacteria 19093
148 Ga0415639_092975 3300038395 Bacteria 1144
149 Ga0466699_086991 3300042597 Bacteria 1032
150 Ga0123357_10087632 3300009784 Bacteria 4071
151 Ga0123355_10000107 3300009826 Bacteria 91810
152 Ga0123355_10286561 3300009826 Bacteria 2266
153 Ga0123356_10001353 3300010049 Bacteria 27104
154 Ga0123356_10010086 3300010049 Bacteria 9290
155 Ga0123356_10074154 3300010049 Bacteria 3201
156 Ga0123356_10314346 3300010049 Bacteria 1677
157 Ga0123353_10006921 3300010167 Bacteria 15238
158 Ga0123353_10085247 3300010167 Bacteria 5087
159 Ga0123353_10853459 3300010167 Bacteria 1248
160 Ga0123354_10249865 3300010882 Bacteria 1800
161 Ga0466704_143944 3300042643 Bacteria 2872
162 Ga0466727_220345 3300042655 Bacteria 3038
163 JGI24702J35022_10095734 3300002462 Bacteria 1620
164 Ga0466706_117213 3300042599 Bacteria 1965
165 Ga0466707_409569 3300042601 Bacteria 15296
166 Ga0466707_411441 3300042601 Bacteria 3237
167 Ga0466714_037982 3300042603 Bacteria 1027
168 Ga0466712_012139 3300042614 Unclassified 2070
169 Ga0466712_146444 3300042614 Bacteria 5866
170 Ga0466712_295793 3300042614 Bacteria 2147
171 Ga0466715_393770 3300042616 Bacteria 24865
172 Ga0466726_059536 3300042619 Bacteria 2086
173 Ga0466729_153244 3300042621 Bacteria 1937
174 Ga0466692_196296 3300042591 Bacteria 21527
175 Ga0466694_156493 3300042594 Bacteria 1001
176 Ga0123357_10003900 3300009784 Bacteria 17312
177 Ga0123355_10386310 3300009826 Bacteria 1819
178 Ga0123356_10000794 3300010049 Bacteria 35034
179 Ga0123356_10417469 3300010049 Bacteria 1483
180 Ga0123353_10049270 3300010167 Bacteria 6710
181 Ga0123353_10260333 3300010167 Unclassified 2680
182 Ga0123354_10027371 3300010882 Bacteria 8984
183 Ga0466704_145886 3300042643 Bacteria 10830
184 Ga0466704_501828 3300042643 Bacteria 1385
185 Ga0466708_145809 3300042652 Bacteria 5215
186 JGI24705J35276_12206755 3300002504 Bacteria 1728
187 Ga0466713_008709 3300042602 Bacteria 25958
188 Ga0466714_114411 3300042603 Bacteria 3297
189 Ga0466722_246821 3300042609 Bacteria 6568
190 Ga0466705_057730 3300042612 Bacteria 4126
191 Ga0466733_101639 3300042659 Bacteria 1820
192 Ga0466726_344148 3300042619 Bacteria 1246
193 Ga0466729_098709 3300042621 Bacteria 12340
194 Ga0466657_007516 3300042582 Bacteria 2611
195 Ga0466692_035097 3300042591 Bacteria 1711
196 Ga0466692_148131 3300042591 Bacteria 11264
197 Ga0123355_10522322 3300009826 Bacteria 1452
198 Ga0123356_10093606 3300010049 Bacteria 2868
199 Ga0123356_10674961 3300010049 Bacteria 1201
200 Ga0123353_10008314 3300010167 Bacteria 14153
201 Ga0123353_10046952 3300010167 Bacteria 6865
202 Ga0123353_10169374 3300010167 Bacteria 3468
203 Ga0123353_10215367 3300010167 Bacteria 3009
204 Ga0123353_10497395 3300010167 Bacteria 1778
205 Ga0123353_10573405 3300010167 Bacteria 1621
206 Ga0123353_11086785 3300010167 Bacteria 1064
207 Ga0123354_10374079 3300010882 Bacteria 1239
208 Ga0466703_160856 3300042636 Bacteria 11787
209 Ga0466708_023256 3300042652 Bacteria 26140
210 Ga0466708_131261 3300042652 Bacteria 11974
211 Ga0466727_005085 3300042655 Unclassified 13337
212 JGI24696J40584_12952625 3300002834 Bacteria 2371
213 Ga0466716_074911 3300042605 Bacteria 4391
214 Ga0466716_476139 3300042605 Bacteria 14403
215 Ga0466719_392124 3300042606 Bacteria 2957

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13242 Hydrolase_like HAD-hyrolase-like 207 279 0.98
PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase 42 135 0.97
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 41 245 0.71

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.