Protein Family IF03202
Metagenome
Isolate
254
Members
85
Samples
215
Scaffolds
265.33
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10217393|Ga0123353_102173932
- Length
- 285 aa
- Sequence
- VLDKDSYSVTVWGNDTVLFEKKRGMMTVMSDIEAIRSKQGYLCDMDGVIYHGNRILEGAWDFVTWLEESGKSYLFLTNASSPTPTDLKNKLARMGLDIDESKFYTSALATAKFLHNQSPGCSAYVIGDSGLVIALNDDVDPDYVVVGETCSYDYEKITKAIDFVMNGAKLIGAHPDMTSPSEEGLIPACRALIAPIELAAERSAYYIGKPNALMMRTGLSMLGVHSSEAAIIGDRMDTDIIAGIETGLETVLVLSGVTSREQVKLFPYRPKYILNNVGEIVISS*
Sample Types
Isolate
15.3%
Metagenome
84.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
32.9%
Termitidae
27.1%
Kalotermitidae
16.5%
Formicidae
8.2%
Rhinotermitidae
4.7%
Termopsidae
2.4%
Passalidae
2.4%
Tenebrionidae
1.2%
Hodotermitidae
1.2%
Scarabaeidae
1.2%
Cimicidae
1.2%
Pentatomidae
1.2%
Taxonomy
Archaea
0
Bacteria
241
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 2 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 5 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 16 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 17 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 18 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 19 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 20 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 21 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 22 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 23 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 28 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 29 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 30 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 31 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 32 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 33 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 41 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 42 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 43 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 44 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 45 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 50 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 51 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 52 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 55 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 56 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 57 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 58 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 59 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 60 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 61 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 62 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 63 | 2819999932 | Unclassified Synergistetes Th196P4bin51 | Isolate | Unclassified |
| 64 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 65 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 66 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 67 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 68 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 69 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 70 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 71 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 72 | 2820931684 | Unclassified Actinobacteria Emb289P1bin89 | Isolate | Unclassified |
| 73 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 74 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 75 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 76 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 77 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 78 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 79 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 80 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 81 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 82 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 83 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 84 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 85 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_110183 | 3300042612 | Bacteria | 12602 |
| 2 | Ga0562376_0311 | 3300056857 | Bacteria | 95811 |
| 3 | Ga0466710_138700 | 3300042613 | Bacteria | 2709 |
| 4 | Ga0466715_010642 | 3300042616 | Bacteria | 9264 |
| 5 | Ga0466723_024030 | 3300042618 | Bacteria | 1919 |
| 6 | Ga0466723_068921 | 3300042618 | Bacteria | 1665 |
| 7 | Ga0466726_329052 | 3300042619 | Unclassified | 2386 |
| 8 | Ga0466728_406006 | 3300042620 | Bacteria | 2842 |
| 9 | Ga0415639_115142 | 3300038395 | Bacteria | 8614 |
| 10 | Ga0466692_058765 | 3300042591 | Bacteria | 30559 |
| 11 | Ga0466696_483230 | 3300042596 | Bacteria | 2611 |
| 12 | Ga0466699_234316 | 3300042597 | Bacteria | 2724 |
| 13 | Ga0466699_283212 | 3300042597 | Bacteria | 1088 |
| 14 | Ga0466699_316695 | 3300042597 | Bacteria | 7985 |
| 15 | Ga0123355_10076018 | 3300009826 | Bacteria | 5373 |
| 16 | Ga0123356_10001785 | 3300010049 | Bacteria | 23465 |
| 17 | Ga0123353_10003046 | 3300010167 | Bacteria | 20988 |
| 18 | Ga0123353_10192746 | 3300010167 | Bacteria | 3215 |
| 19 | Ga0123353_10444597 | 3300010167 | Bacteria | 1911 |
| 20 | Ga0466703_300871 | 3300042636 | Bacteria | 15230 |
| 21 | Ga0466704_441494 | 3300042643 | Bacteria | 4903 |
| 22 | Ga0466709_078685 | 3300042648 | Bacteria | 5023 |
| 23 | Ga0466727_256006 | 3300042655 | Bacteria | 2692 |
| 24 | 2227619075 | 2225789004 | Unclassified | 11842 |
| 25 | IMNBL1DRAFT_c0047541 | 3300000062 | Bacteria | 1384 |
| 26 | JGI24702J35022_10023882 | 3300002462 | Unclassified | 3304 |
| 27 | JGI24702J35022_10355629 | 3300002462 | Bacteria | 876 |
| 28 | Ga0466700_014821 | 3300042600 | Bacteria | 1604 |
| 29 | Ga0466707_346372 | 3300042601 | Bacteria | 1447 |
| 30 | Ga0466707_365807 | 3300042601 | Bacteria | 2591 |
| 31 | Ga0466707_396159 | 3300042601 | Bacteria | 1546 |
| 32 | Ga0466719_016189 | 3300042606 | Bacteria | 5219 |
| 33 | Ga0466719_022377 | 3300042606 | Bacteria | 5362 |
| 34 | Ga0466719_150059 | 3300042606 | Bacteria | 20768 |
| 35 | Ga0466719_225246 | 3300042606 | Bacteria | 3384 |
| 36 | Ga0466722_072461 | 3300042609 | Bacteria | 12361 |
| 37 | Ga0466705_050542 | 3300042612 | Bacteria | 9653 |
| 38 | Ga0466712_074297 | 3300042614 | Bacteria | 1899 |
| 39 | Ga0466711_166710 | 3300042615 | Bacteria | 26303 |
| 40 | Ga0466715_061123 | 3300042616 | Bacteria | 10345 |
| 41 | Ga0466723_082532 | 3300042618 | Bacteria | 11610 |
| 42 | Ga0466726_321135 | 3300042619 | Bacteria | 5018 |
| 43 | Ga0466726_420642 | 3300042619 | Bacteria | 3225 |
| 44 | Ga0466728_254100 | 3300042620 | Bacteria | 1311 |
| 45 | Ga0466728_254297 | 3300042620 | Unclassified | 4434 |
| 46 | Ga0466690_279543 | 3300042590 | Bacteria | 4422 |
| 47 | Ga0466692_008596 | 3300042591 | Unclassified | 5079 |
| 48 | Ga0466692_187572 | 3300042591 | Bacteria | 21965 |
| 49 | Ga0466691_145985 | 3300042593 | Bacteria | 16856 |
| 50 | Ga0466699_424769 | 3300042597 | Bacteria | 1340 |
| 51 | Ga0123356_10010303 | 3300010049 | Bacteria | 9181 |
| 52 | Ga0123356_10298876 | 3300010049 | Bacteria | 1714 |
| 53 | Ga0123356_10309493 | 3300010049 | Bacteria | 1688 |
| 54 | Ga0123356_10413964 | 3300010049 | Bacteria | 1488 |
| 55 | Ga0123356_10863436 | 3300010049 | Bacteria | 1076 |
| 56 | Ga0123353_10235363 | 3300010167 | Bacteria | 2851 |
| 57 | Ga0123354_10100404 | 3300010882 | Bacteria | 3917 |
| 58 | Ga0466703_012892 | 3300042636 | Bacteria | 3571 |
| 59 | Ga0466709_170433 | 3300042648 | Bacteria | 14693 |
| 60 | 2227536063 | 2225789004 | Bacteria | 3066 |
| 61 | Ga0123357_10000374 | 3300009784 | Bacteria | 42320 |
| 62 | Ga0466700_105706 | 3300042600 | Bacteria | 1457 |
| 63 | Ga0466700_390800 | 3300042600 | Bacteria | 2438 |
| 64 | Ga0466716_129079 | 3300042605 | Bacteria | 2827 |
| 65 | Ga0466722_085250 | 3300042609 | Bacteria | 11239 |
| 66 | Ga0466722_261341 | 3300042609 | Bacteria | 2203 |
| 67 | Ga0466698_001196 | 3300042610 | Bacteria | 1411 |
| 68 | Ga0466705_126394 | 3300042612 | Bacteria | 14291 |
| 69 | Ga0466733_172465 | 3300042659 | Bacteria | 2100 |
| 70 | Ga0466705_471867 | 3300042612 | Bacteria | 10275 |
| 71 | Ga0466711_074425 | 3300042615 | Bacteria | 2639 |
| 72 | Ga0466711_499263 | 3300042615 | Bacteria | 6008 |
| 73 | Ga0466715_347325 | 3300042616 | Bacteria | 3206 |
| 74 | Ga0466726_108932 | 3300042619 | Bacteria | 1969 |
| 75 | Ga0466728_011483 | 3300042620 | Bacteria | 2428 |
| 76 | Ga0466729_124248 | 3300042621 | Bacteria | 1372 |
| 77 | Ga0466690_149414 | 3300042590 | Bacteria | 15159 |
| 78 | Ga0466692_015656 | 3300042591 | Bacteria | 13711 |
| 79 | Ga0466696_367695 | 3300042596 | Bacteria | 6269 |
| 80 | Ga0466699_361450 | 3300042597 | Unclassified | 1029 |
| 81 | Ga0123355_10090805 | 3300009826 | Bacteria | 4844 |
| 82 | Ga0123355_10231170 | 3300009826 | Bacteria | 2640 |
| 83 | Ga0123356_10050811 | 3300010049 | Bacteria | 3857 |
| 84 | Ga0123356_10725654 | 3300010049 | Bacteria | 1163 |
| 85 | Ga0123356_10945048 | 3300010049 | Bacteria | 1033 |
| 86 | Ga0123353_10374631 | 3300010167 | Bacteria | 2132 |
| 87 | Ga0466704_268396 | 3300042643 | Bacteria | 2542 |
| 88 | Ga0466704_505608 | 3300042643 | Bacteria | 19210 |
| 89 | Ga0466708_220977 | 3300042652 | Bacteria | 2802 |
| 90 | Ga0466727_166421 | 3300042655 | Bacteria | 2395 |
| 91 | IMNBL1DRAFT_c0000228 | 3300000062 | Bacteria | 49223 |
| 92 | IMNBL1DRAFT_c0004015 | 3300000062 | Bacteria | 9059 |
| 93 | Ga0466706_154583 | 3300042599 | Unclassified | 2608 |
| 94 | Ga0466706_240415 | 3300042599 | Unclassified | 4384 |
| 95 | Ga0466714_052671 | 3300042603 | Bacteria | 2761 |
| 96 | Ga0466698_396459 | 3300042610 | Bacteria | 2505 |
| 97 | Ga0466697_101231 | 3300042611 | Bacteria | 2031 |
| 98 | Ga0466733_217158 | 3300042659 | Bacteria | 7604 |
| 99 | Ga0466712_015286 | 3300042614 | Bacteria | 15756 |
| 100 | Ga0466712_170606 | 3300042614 | Bacteria | 45022 |
| 101 | Ga0466711_152736 | 3300042615 | Bacteria | 27966 |
| 102 | Ga0466728_204104 | 3300042620 | Bacteria | 4518 |
| 103 | Ga0456237_0004756 | 3300041968 | Unclassified | 2174 |
| 104 | Ga0466691_051458 | 3300042593 | Bacteria | 13212 |
| 105 | Ga0466696_232064 | 3300042596 | Bacteria | 6109 |
| 106 | Ga0466696_282647 | 3300042596 | Bacteria | 3558 |
| 107 | Ga0123355_10040352 | 3300009826 | Bacteria | 7596 |
| 108 | Ga0123355_10058881 | 3300009826 | Bacteria | 6212 |
| 109 | Ga0123356_10010537 | 3300010049 | Bacteria | 9065 |
| 110 | Ga0123356_10216177 | 3300010049 | Bacteria | 1970 |
| 111 | Ga0123353_10043491 | 3300010167 | Bacteria | 7116 |
| 112 | Ga0123353_10217393 | 3300010167 | Bacteria | 2992 |
| 113 | Ga0466703_309847 | 3300042636 | Bacteria | 4994 |
| 114 | Ga0466708_109293 | 3300042652 | Bacteria | 9912 |
| 115 | Ga0466708_266879 | 3300042652 | Bacteria | 7667 |
| 116 | Ga0466708_295631 | 3300042652 | Bacteria | 6461 |
| 117 | IMNBL1DRAFT_c0000240 | 3300000062 | Bacteria | 48221 |
| 118 | IMNBL1DRAFT_c0028905 | 3300000062 | Bacteria | 2059 |
| 119 | JGI24702J35022_10065038 | 3300002462 | Bacteria | 1956 |
| 120 | Ga0466700_427196 | 3300042600 | Bacteria | 1614 |
| 121 | Ga0466714_085163 | 3300042603 | Bacteria | 1108 |
| 122 | Ga0466722_222999 | 3300042609 | Bacteria | 2750 |
| 123 | Ga0466705_344698 | 3300042612 | Bacteria | 1122 |
| 124 | Ga0466711_099157 | 3300042615 | Bacteria | 2267 |
| 125 | Ga0466715_346322 | 3300042616 | Bacteria | 84028 |
| 126 | Ga0466728_028747 | 3300042620 | Bacteria | 6061 |
| 127 | Ga0466691_102405 | 3300042593 | Bacteria | 18269 |
| 128 | Ga0466696_289999 | 3300042596 | Bacteria | 4604 |
| 129 | Ga0466699_076159 | 3300042597 | Bacteria | 2041 |
| 130 | Ga0466699_253007 | 3300042597 | Bacteria | 2116 |
| 131 | Ga0466703_371449 | 3300042636 | Bacteria | 1672 |
| 132 | Ga0466704_034160 | 3300042643 | Bacteria | 21086 |
| 133 | Ga0466727_336836 | 3300042655 | Bacteria | 1580 |
| 134 | JGI24696J40584_12961432 | 3300002834 | Bacteria | 15972 |
| 135 | Ga0466701_043122 | 3300042598 | Bacteria | 3936 |
| 136 | Ga0466700_142401 | 3300042600 | Bacteria | 1826 |
| 137 | Ga0466707_163303 | 3300042601 | Bacteria | 4189 |
| 138 | Ga0466714_099424 | 3300042603 | Bacteria | 1266 |
| 139 | Ga0466719_149701 | 3300042606 | Bacteria | 5785 |
| 140 | Ga0466722_161547 | 3300042609 | Bacteria | 1250 |
| 141 | Ga0466722_213201 | 3300042609 | Bacteria | 1485 |
| 142 | Ga0466705_139824 | 3300042612 | Bacteria | 61712 |
| 143 | Ga0466705_243763 | 3300042612 | Unclassified | 2772 |
| 144 | Ga0466710_175991 | 3300042613 | Bacteria | 1095 |
| 145 | Ga0466711_259424 | 3300042615 | Bacteria | 2117 |
| 146 | Ga0466723_064185 | 3300042618 | Bacteria | 19759 |
| 147 | Ga0466728_164939 | 3300042620 | Bacteria | 19093 |
| 148 | Ga0415639_092975 | 3300038395 | Bacteria | 1144 |
| 149 | Ga0466699_086991 | 3300042597 | Bacteria | 1032 |
| 150 | Ga0123357_10087632 | 3300009784 | Bacteria | 4071 |
| 151 | Ga0123355_10000107 | 3300009826 | Bacteria | 91810 |
| 152 | Ga0123355_10286561 | 3300009826 | Bacteria | 2266 |
| 153 | Ga0123356_10001353 | 3300010049 | Bacteria | 27104 |
| 154 | Ga0123356_10010086 | 3300010049 | Bacteria | 9290 |
| 155 | Ga0123356_10074154 | 3300010049 | Bacteria | 3201 |
| 156 | Ga0123356_10314346 | 3300010049 | Bacteria | 1677 |
| 157 | Ga0123353_10006921 | 3300010167 | Bacteria | 15238 |
| 158 | Ga0123353_10085247 | 3300010167 | Bacteria | 5087 |
| 159 | Ga0123353_10853459 | 3300010167 | Bacteria | 1248 |
| 160 | Ga0123354_10249865 | 3300010882 | Bacteria | 1800 |
| 161 | Ga0466704_143944 | 3300042643 | Bacteria | 2872 |
| 162 | Ga0466727_220345 | 3300042655 | Bacteria | 3038 |
| 163 | JGI24702J35022_10095734 | 3300002462 | Bacteria | 1620 |
| 164 | Ga0466706_117213 | 3300042599 | Bacteria | 1965 |
| 165 | Ga0466707_409569 | 3300042601 | Bacteria | 15296 |
| 166 | Ga0466707_411441 | 3300042601 | Bacteria | 3237 |
| 167 | Ga0466714_037982 | 3300042603 | Bacteria | 1027 |
| 168 | Ga0466712_012139 | 3300042614 | Unclassified | 2070 |
| 169 | Ga0466712_146444 | 3300042614 | Bacteria | 5866 |
| 170 | Ga0466712_295793 | 3300042614 | Bacteria | 2147 |
| 171 | Ga0466715_393770 | 3300042616 | Bacteria | 24865 |
| 172 | Ga0466726_059536 | 3300042619 | Bacteria | 2086 |
| 173 | Ga0466729_153244 | 3300042621 | Bacteria | 1937 |
| 174 | Ga0466692_196296 | 3300042591 | Bacteria | 21527 |
| 175 | Ga0466694_156493 | 3300042594 | Bacteria | 1001 |
| 176 | Ga0123357_10003900 | 3300009784 | Bacteria | 17312 |
| 177 | Ga0123355_10386310 | 3300009826 | Bacteria | 1819 |
| 178 | Ga0123356_10000794 | 3300010049 | Bacteria | 35034 |
| 179 | Ga0123356_10417469 | 3300010049 | Bacteria | 1483 |
| 180 | Ga0123353_10049270 | 3300010167 | Bacteria | 6710 |
| 181 | Ga0123353_10260333 | 3300010167 | Unclassified | 2680 |
| 182 | Ga0123354_10027371 | 3300010882 | Bacteria | 8984 |
| 183 | Ga0466704_145886 | 3300042643 | Bacteria | 10830 |
| 184 | Ga0466704_501828 | 3300042643 | Bacteria | 1385 |
| 185 | Ga0466708_145809 | 3300042652 | Bacteria | 5215 |
| 186 | JGI24705J35276_12206755 | 3300002504 | Bacteria | 1728 |
| 187 | Ga0466713_008709 | 3300042602 | Bacteria | 25958 |
| 188 | Ga0466714_114411 | 3300042603 | Bacteria | 3297 |
| 189 | Ga0466722_246821 | 3300042609 | Bacteria | 6568 |
| 190 | Ga0466705_057730 | 3300042612 | Bacteria | 4126 |
| 191 | Ga0466733_101639 | 3300042659 | Bacteria | 1820 |
| 192 | Ga0466726_344148 | 3300042619 | Bacteria | 1246 |
| 193 | Ga0466729_098709 | 3300042621 | Bacteria | 12340 |
| 194 | Ga0466657_007516 | 3300042582 | Bacteria | 2611 |
| 195 | Ga0466692_035097 | 3300042591 | Bacteria | 1711 |
| 196 | Ga0466692_148131 | 3300042591 | Bacteria | 11264 |
| 197 | Ga0123355_10522322 | 3300009826 | Bacteria | 1452 |
| 198 | Ga0123356_10093606 | 3300010049 | Bacteria | 2868 |
| 199 | Ga0123356_10674961 | 3300010049 | Bacteria | 1201 |
| 200 | Ga0123353_10008314 | 3300010167 | Bacteria | 14153 |
| 201 | Ga0123353_10046952 | 3300010167 | Bacteria | 6865 |
| 202 | Ga0123353_10169374 | 3300010167 | Bacteria | 3468 |
| 203 | Ga0123353_10215367 | 3300010167 | Bacteria | 3009 |
| 204 | Ga0123353_10497395 | 3300010167 | Bacteria | 1778 |
| 205 | Ga0123353_10573405 | 3300010167 | Bacteria | 1621 |
| 206 | Ga0123353_11086785 | 3300010167 | Bacteria | 1064 |
| 207 | Ga0123354_10374079 | 3300010882 | Bacteria | 1239 |
| 208 | Ga0466703_160856 | 3300042636 | Bacteria | 11787 |
| 209 | Ga0466708_023256 | 3300042652 | Bacteria | 26140 |
| 210 | Ga0466708_131261 | 3300042652 | Bacteria | 11974 |
| 211 | Ga0466727_005085 | 3300042655 | Unclassified | 13337 |
| 212 | JGI24696J40584_12952625 | 3300002834 | Bacteria | 2371 |
| 213 | Ga0466716_074911 | 3300042605 | Bacteria | 4391 |
| 214 | Ga0466716_476139 | 3300042605 | Bacteria | 14403 |
| 215 | Ga0466719_392124 | 3300042606 | Bacteria | 2957 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.