Protein Family IF03153

Metagenome Isolate
124 Members
45 Samples
111 Scaffolds
150.81 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10129878|Ga0123353_101298782
Length
167 aa
Sequence
LLIDYVNNHSVDVPARNEKYNEYVSKMTPKSRKWPSLLWAFLIGGLICIIGEGLYLLFDQVIFTGYDGGNIGSLVAATLIIIAAILTGFGIYDKLGTFAGGGSLVPITGFSNSITSAAMEHRKEGIIFGTCSHMFKIAGPVIVVGIALSILVGFVYWILLISGVPI*

📊 Sample Types

Isolate 10.5%
Metagenome 89.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.6%
Unclassified 31.1%
Kalotermitidae 20.0%
Passalidae 4.4%
Termopsidae 4.4%
Scarabaeidae 2.2%
Hodotermitidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
3 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
4 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
7 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
10 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
11 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
12 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
13 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
14 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
20 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
21 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
22 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
23 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
28 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
29 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
30 2820546020 Unclassified Firmicutes Lab288P1bin102 Isolate Unclassified
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
35 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
36 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
37 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
38 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
39 2820468515 Unclassified Firmicutes Lab288P1bin95 Isolate Unclassified
40 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
41 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
42 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
43 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
44 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
45 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10175508 3300009826 Bacteria 3192
2 Ga0123355_10283778 3300009826 Unclassified 2282
3 Ga0123355_10371932 3300009826 Bacteria 1871
4 Ga0123356_11095228 3300010049 Bacteria 965
5 Ga0123353_10105031 3300010167 Bacteria 4552
6 Ga0123353_10384926 3300010167 Unclassified 2096
7 Ga0123353_11160223 3300010167 Bacteria 1018
8 Ga0123353_11303733 3300010167 Bacteria 943
9 Ga0466704_033932 3300042643 Bacteria 38425
10 JGI24696J40584_12956883 3300002834 Bacteria 3272
11 Ga0466706_067390 3300042599 Bacteria 55994
12 Ga0466706_117383 3300042599 Bacteria 18920
13 Ga0466706_191404 3300042599 Bacteria 1283
14 Ga0466693_441214 3300042592 Bacteria 3247
15 Ga0123357_10626942 3300009784 Bacteria 809
16 Ga0123355_11236546 3300009826 Bacteria 758
17 Ga0123356_10005464 3300010049 Bacteria 12929
18 Ga0123356_10438898 3300010049 Bacteria 1451
19 Ga0123353_10014602 3300010167 Bacteria 11338
20 Ga0123353_12274213 3300010167 Bacteria 653
21 Ga0123353_12598009 3300010167 Unclassified 599
22 IMNBL1DRAFT_c0004203 3300000062 Bacteria 8750
23 JGI24696J40584_12726682 3300002834 Bacteria 765
24 Ga0466706_086180 3300042599 Bacteria 10178
25 Ga0466706_113500 3300042599 Unclassified 10173
26 Ga0466714_066720 3300042603 Bacteria 37141
27 Ga0466712_224918 3300042614 Bacteria 2258
28 Ga0466696_031099 3300042596 Bacteria 39724
29 Ga0123355_10098700 3300009826 Bacteria 4605
30 Ga0123356_10162682 3300010049 Bacteria 2232
31 Ga0123356_11484703 3300010049 Bacteria 836
32 Ga0123353_10208531 3300010167 Bacteria 3067
33 Ga0123353_10687183 3300010167 Bacteria 1440
34 Ga0123354_10204440 3300010882 Unclassified 2158
35 Ga0068305_11143910 3300005083 Bacteria 844
36 Ga0466706_068513 3300042599 Bacteria 30909
37 Ga0466714_080726 3300042603 Bacteria 1397
38 Ga0466718_071577 3300042617 Bacteria 13991
39 Ga0415639_000888 3300038395 Bacteria 139331
40 Ga0123355_10203733 3300009826 Bacteria 2884
41 Ga0123355_11010041 3300009826 Bacteria 882
42 Ga0123353_10537274 3300010167 Bacteria 1690
43 Ga0123353_11056295 3300010167 Bacteria 1084
44 Ga0123353_11142699 3300010167 Bacteria 1029
45 JGI24705J35276_12238447 3300002504 Bacteria 22484
46 Ga0466719_315545 3300042606 Bacteria 4084
47 Ga0466718_084652 3300042617 Bacteria 1800
48 Ga0466733_075580 3300042659 Bacteria 1259
49 Ga0466733_163158 3300042659 Bacteria 6954
50 Ga0466690_153137 3300042590 Bacteria 8498
51 Ga0123355_10394745 3300009826 Bacteria 1790
52 Ga0123353_10255890 3300010167 Bacteria 2708
53 Ga0123353_11088371 3300010167 Bacteria 1063
54 Ga0123353_11837266 3300010167 Unclassified 751
55 IMNBL1DRAFT_c0000026 3300000062 Bacteria 139385
56 JGI24702J35022_10081887 3300002462 Bacteria 1749
57 Ga0466706_145975 3300042599 Bacteria 17658
58 Ga0466714_039398 3300042603 Bacteria 3993
59 Ga0466733_119161 3300042659 Bacteria 2219
60 Ga0466733_167723 3300042659 Bacteria 1614
61 Ga0123355_10180354 3300009826 Bacteria 3135
62 Ga0123355_10227306 3300009826 Bacteria 2671
63 Ga0123355_10524604 3300009826 Bacteria 1447
64 Ga0123355_11124294 3300009826 Bacteria 813
65 Ga0123356_10425612 3300010049 Bacteria 1471
66 Ga0123356_12439844 3300010049 Bacteria 654
67 Ga0123353_10001867 3300010167 Bacteria 25939
68 Ga0123353_10129878 3300010167 Bacteria 4045
69 Ga0466704_169082 3300042643 Bacteria 10477
70 Ga0466727_250454 3300042655 Bacteria 6092
71 Ga0466707_133690 3300042601 Bacteria 13939
72 Ga0466714_161136 3300042603 Bacteria 4069
73 Ga0466705_119306 3300042612 Bacteria 4022
74 Ga0466726_176702 3300042619 Bacteria 18406
75 Ga0466733_156157 3300042659 Bacteria 3033
76 Ga0123357_10417213 3300009784 Bacteria 1202
77 Ga0123355_10018165 3300009826 Bacteria 11140
78 Ga0123355_10066597 3300009826 Bacteria 5797
79 Ga0123356_10021080 3300010049 Bacteria 6163
80 Ga0123356_10181346 3300010049 Bacteria 2127
81 Ga0123356_11123440 3300010049 Bacteria 954
82 Ga0123356_11737209 3300010049 Bacteria 775
83 Ga0123356_12377235 3300010049 Bacteria 663
84 Ga0123353_10214449 3300010167 Bacteria 3017
85 Ga0466703_250352 3300042636 Bacteria 3124
86 JGI24705J35276_11477562 3300002504 Bacteria 550
87 Ga0074263_129431 3300005485 Bacteria 869
88 Ga0466706_103234 3300042599 Bacteria 11904
89 Ga0466706_169663 3300042599 Bacteria 1792
90 Ga0466706_281829 3300042599 Bacteria 79600
91 Ga0466707_322496 3300042601 Bacteria 7035
92 Ga0466714_080441 3300042603 Bacteria 2391
93 Ga0466719_260400 3300042606 Bacteria 7180
94 Ga0466698_310072 3300042610 Bacteria 1270
95 Ga0466696_391928 3300042596 Bacteria 5120
96 Ga0123355_10992639 3300009826 Bacteria 893
97 Ga0123355_11535048 3300009826 Bacteria 647
98 Ga0123356_10000006 3300010049 Bacteria 247371
99 Ga0123356_10025488 3300010049 Unclassified 5559
100 Ga0123356_10145665 3300010049 Bacteria 2343
101 Ga0123353_10018195 3300010167 Bacteria 10377
102 Ga0123353_10870046 3300010167 Bacteria 1232
103 2227548807 2225789004 Bacteria 2879
104 IMNBL1DRAFT_c0099142 3300000062 Bacteria 786
105 Ga0466706_095011 3300042599 Bacteria 3441
106 Ga0466706_255326 3300042599 Bacteria 15699
107 Ga0466714_153600 3300042603 Bacteria 1206
108 Ga0466705_491157 3300042612 Bacteria 6380
109 Ga0466711_074960 3300042615 Bacteria 2238
110 Ga0466715_534628 3300042616 Bacteria 35124
111 Ga0466728_030317 3300042620 Bacteria 5505

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03862 SpoVAC_SpoVAEB SpoVAC/SpoVAEB sporulation membrane protein 37 155 0.93

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.