Protein Family IF03140
Metagenome
Isolate
188
Members
50
Samples
183
Scaffolds
97.16
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10109964|Ga0123353_101099644
- Length
- 117 aa
- Sequence
- MPYICSPKNKYIIHLNYFIVMTKADIVNAIARNTGIDRASALACVEGFMEEVMNSMNQGENVYLRGFGSFVVKKRAAKAARHIKNETTLMIPERFVPTFKPSQYFVENLRNSLDQK*
Sample Types
Isolate
2.7%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.0%
Kalotermitidae
28.0%
Unclassified
14.0%
Termopsidae
6.0%
Rhinotermitidae
6.0%
Passalidae
4.0%
Blattidae
2.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
165
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 4 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 5 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 6 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 7 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 8 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 9 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 10 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 11 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 29 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 30 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 35 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 36 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 37 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 38 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 39 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 41 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 42 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 48 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 49 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 50 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466726_052804 | 3300042619 | Bacteria | 9565 |
| 2 | Ga0123357_10565058 | 3300009784 | Unclassified | 897 |
| 3 | Ga0123354_10023484 | 3300010882 | Bacteria | 9726 |
| 4 | Ga0123354_10075983 | 3300010882 | Bacteria | 4800 |
| 5 | 2227609068 | 2225789004 | Unclassified | 2275 |
| 6 | JGI24705J35276_12144089 | 3300002504 | Unclassified | 1153 |
| 7 | JGI24696J40584_12805258 | 3300002834 | Unclassified | 877 |
| 8 | Ga0123357_10000445 | 3300009784 | Bacteria | 39844 |
| 9 | Ga0466719_005683 | 3300042606 | Bacteria | 1278 |
| 10 | Ga0466719_517098 | 3300042606 | Bacteria | 2194 |
| 11 | Ga0466698_305203 | 3300042610 | Bacteria | 4643 |
| 12 | Ga0466705_076961 | 3300042612 | Bacteria | 4515 |
| 13 | Ga0466725_452838 | 3300042654 | Unclassified | 1169 |
| 14 | Ga0466690_076723 | 3300042590 | Bacteria | 4233 |
| 15 | Ga0466692_004086 | 3300042591 | Bacteria | 2193 |
| 16 | Ga0466696_116206 | 3300042596 | Bacteria | 18134 |
| 17 | Ga0466705_522885 | 3300042612 | Bacteria | 2842 |
| 18 | Ga0466710_127284 | 3300042613 | Bacteria | 1711 |
| 19 | Ga0466715_054289 | 3300042616 | Bacteria | 15475 |
| 20 | Ga0466715_459299 | 3300042616 | Bacteria | 15738 |
| 21 | Ga0466723_190362 | 3300042618 | Bacteria | 3402 |
| 22 | Ga0466726_046595 | 3300042619 | Bacteria | 30556 |
| 23 | Ga0466729_107829 | 3300042621 | Bacteria | 2876 |
| 24 | Ga0123357_10088628 | 3300009784 | Bacteria | 4043 |
| 25 | Ga0123354_10000201 | 3300010882 | Bacteria | 51540 |
| 26 | Ga0123354_10102465 | 3300010882 | Unclassified | 3858 |
| 27 | JGI24702J35022_10153821 | 3300002462 | Bacteria | 1292 |
| 28 | JGI24705J35276_12229766 | 3300002504 | Bacteria | 3461 |
| 29 | JGI24696J40584_12905166 | 3300002834 | Unclassified | 1212 |
| 30 | JGI24696J40584_12959802 | 3300002834 | Bacteria | 5682 |
| 31 | Ga0466701_036031 | 3300042598 | Bacteria | 1687 |
| 32 | Ga0466707_338142 | 3300042601 | Bacteria | 23698 |
| 33 | Ga0466716_144281 | 3300042605 | Bacteria | 9917 |
| 34 | Ga0466719_004777 | 3300042606 | Bacteria | 29050 |
| 35 | Ga0466719_423267 | 3300042606 | Bacteria | 11355 |
| 36 | Ga0466722_243730 | 3300042609 | Bacteria | 4046 |
| 37 | Ga0466735_022443 | 3300042624 | Bacteria | 2962 |
| 38 | Ga0466735_120532 | 3300042624 | Bacteria | 2563 |
| 39 | Ga0466735_169333 | 3300042624 | Unclassified | 1232 |
| 40 | Ga0466704_075296 | 3300042643 | Bacteria | 42602 |
| 41 | Ga0466704_621886 | 3300042643 | Bacteria | 31412 |
| 42 | Ga0466727_085133 | 3300042655 | Bacteria | 23683 |
| 43 | Ga0466727_308046 | 3300042655 | Bacteria | 6145 |
| 44 | Ga0466696_466996 | 3300042596 | Bacteria | 1582 |
| 45 | Ga0466705_413942 | 3300042612 | Bacteria | 1089 |
| 46 | Ga0466715_159912 | 3300042616 | Bacteria | 1757 |
| 47 | Ga0466726_080380 | 3300042619 | Bacteria | 8611 |
| 48 | Ga0123357_10017697 | 3300009784 | Bacteria | 9442 |
| 49 | Ga0123357_10225876 | 3300009784 | Bacteria | 2065 |
| 50 | Ga0123357_10284138 | 3300009784 | Unclassified | 1703 |
| 51 | Ga0123357_10783839 | 3300009784 | Bacteria | 651 |
| 52 | Ga0123354_10613296 | 3300010882 | Bacteria | 792 |
| 53 | 2227350224 | 2225789004 | Bacteria | 6181 |
| 54 | IMNBL1DRAFT_c0002915 | 3300000062 | Bacteria | 11445 |
| 55 | IMNBL1DRAFT_c0004165 | 3300000062 | Bacteria | 8795 |
| 56 | IMNBL1DRAFT_c0009166 | 3300000062 | Bacteria | 4929 |
| 57 | IMNBL1DRAFT_c0019820 | 3300000062 | Bacteria | 2743 |
| 58 | Ga0068305_10350063 | 3300005083 | Bacteria | 5393 |
| 59 | Ga0466701_017652 | 3300042598 | Bacteria | 77230 |
| 60 | Ga0466707_146418 | 3300042601 | Bacteria | 49406 |
| 61 | Ga0466713_077457 | 3300042602 | Bacteria | 1903 |
| 62 | Ga0466719_076842 | 3300042606 | Bacteria | 3108 |
| 63 | Ga0466719_572882 | 3300042606 | Bacteria | 1223 |
| 64 | Ga0466729_228912 | 3300042621 | Bacteria | 1127 |
| 65 | Ga0466690_026988 | 3300042590 | Bacteria | 18621 |
| 66 | Ga0466690_176257 | 3300042590 | Bacteria | 7605 |
| 67 | Ga0466692_058282 | 3300042591 | Bacteria | 1279 |
| 68 | Ga0466691_067196 | 3300042593 | Bacteria | 21479 |
| 69 | Ga0466715_105177 | 3300042616 | Bacteria | 12080 |
| 70 | Ga0466715_489251 | 3300042616 | Bacteria | 3306 |
| 71 | Ga0123357_10010185 | 3300009784 | Unclassified | 11936 |
| 72 | Ga0123356_11405079 | 3300010049 | Unclassified | 858 |
| 73 | Ga0123354_10004885 | 3300010882 | Bacteria | 19219 |
| 74 | IMNBL1DRAFT_c0078592 | 3300000062 | Bacteria | 930 |
| 75 | IMNBL1DRAFT_c0133489 | 3300000062 | Bacteria | 645 |
| 76 | Ga0123357_10002416 | 3300009784 | Bacteria | 20828 |
| 77 | Ga0466706_055305 | 3300042599 | Bacteria | 1190 |
| 78 | Ga0466707_189059 | 3300042601 | Bacteria | 7875 |
| 79 | Ga0466707_420065 | 3300042601 | Bacteria | 1951 |
| 80 | Ga0466713_007766 | 3300042602 | Bacteria | 67445 |
| 81 | Ga0466716_162458 | 3300042605 | Bacteria | 2608 |
| 82 | Ga0466735_023200 | 3300042624 | Bacteria | 3895 |
| 83 | Ga0466703_281365 | 3300042636 | Bacteria | 9089 |
| 84 | Ga0466704_286775 | 3300042643 | Bacteria | 3414 |
| 85 | Ga0466704_456552 | 3300042643 | Bacteria | 3120 |
| 86 | Ga0466704_586799 | 3300042643 | Bacteria | 9380 |
| 87 | Ga0466708_139920 | 3300042652 | Bacteria | 25293 |
| 88 | Ga0466727_179474 | 3300042655 | Bacteria | 2903 |
| 89 | Ga0466690_276223 | 3300042590 | Bacteria | 213056 |
| 90 | Ga0466692_008016 | 3300042591 | Bacteria | 17376 |
| 91 | Ga0466692_085363 | 3300042591 | Bacteria | 2340 |
| 92 | Ga0466692_178028 | 3300042591 | Bacteria | 52823 |
| 93 | Ga0466711_221387 | 3300042615 | Bacteria | 14251 |
| 94 | Ga0466726_088483 | 3300042619 | Bacteria | 2057 |
| 95 | Ga0123354_10134603 | 3300010882 | Bacteria | 3099 |
| 96 | Ga0123354_10728467 | 3300010882 | Bacteria | 685 |
| 97 | IMNBL1DRAFT_c0078174 | 3300000062 | Bacteria | 934 |
| 98 | JGI24702J35022_10005850 | 3300002462 | Bacteria | 7153 |
| 99 | Ga0466706_218899 | 3300042599 | Bacteria | 4292 |
| 100 | Ga0466700_054481 | 3300042600 | Bacteria | 7148 |
| 101 | Ga0466707_013976 | 3300042601 | Bacteria | 1633 |
| 102 | Ga0466707_278974 | 3300042601 | Bacteria | 3029 |
| 103 | Ga0466719_211662 | 3300042606 | Unclassified | 1381 |
| 104 | Ga0466697_217332 | 3300042611 | Bacteria | 1687 |
| 105 | Ga0466729_268762 | 3300042621 | Bacteria | 2321 |
| 106 | Ga0466735_113157 | 3300042624 | Bacteria | 5196 |
| 107 | Ga0466703_085557 | 3300042636 | Bacteria | 2047 |
| 108 | Ga0466703_155626 | 3300042636 | Unclassified | 1620 |
| 109 | Ga0466704_007516 | 3300042643 | Bacteria | 24581 |
| 110 | Ga0466709_096114 | 3300042648 | Bacteria | 7314 |
| 111 | Ga0466692_026125 | 3300042591 | Bacteria | 30408 |
| 112 | Ga0466694_292983 | 3300042594 | Bacteria | 3349 |
| 113 | Ga0123357_10038580 | 3300009784 | Bacteria | 6504 |
| 114 | Ga0123354_10002288 | 3300010882 | Bacteria | 25043 |
| 115 | Ga0123354_10108383 | 3300010882 | Bacteria | 3689 |
| 116 | IMNBL1DRAFT_c0000966 | 3300000062 | Bacteria | 22205 |
| 117 | JGI24702J35022_10005841 | 3300002462 | Bacteria | 7157 |
| 118 | JGI24705J35276_11502209 | 3300002504 | Unclassified | 558 |
| 119 | JGI24705J35276_11743043 | 3300002504 | Unclassified | 653 |
| 120 | JGI24699J35502_11133651 | 3300002509 | Bacteria | 12945 |
| 121 | Ga0466701_088409 | 3300042598 | Bacteria | 49099 |
| 122 | Ga0466713_088520 | 3300042602 | Bacteria | 50636 |
| 123 | Ga0466717_195832 | 3300042604 | Bacteria | 1465 |
| 124 | Ga0466722_036237 | 3300042609 | Bacteria | 8342 |
| 125 | Ga0466698_400083 | 3300042610 | Unclassified | 1057 |
| 126 | Ga0466735_100553 | 3300042624 | Bacteria | 1269 |
| 127 | Ga0466735_133735 | 3300042624 | Bacteria | 22495 |
| 128 | Ga0466735_158546 | 3300042624 | Bacteria | 1975 |
| 129 | Ga0466735_213875 | 3300042624 | Bacteria | 6087 |
| 130 | Ga0466703_176373 | 3300042636 | Bacteria | 12107 |
| 131 | Ga0466703_254927 | 3300042636 | Bacteria | 1983 |
| 132 | Ga0466704_454748 | 3300042643 | Bacteria | 12640 |
| 133 | Ga0466727_290402 | 3300042655 | Bacteria | 1429 |
| 134 | Ga0466656_019025 | 3300042550 | Bacteria | 3271 |
| 135 | Ga0466691_100249 | 3300042593 | Bacteria | 5152 |
| 136 | Ga0466696_328182 | 3300042596 | Bacteria | 1375 |
| 137 | Ga0466711_198868 | 3300042615 | Bacteria | 6592 |
| 138 | Ga0466723_042046 | 3300042618 | Bacteria | 9471 |
| 139 | Ga0466728_183471 | 3300042620 | Bacteria | 7847 |
| 140 | Ga0466728_392041 | 3300042620 | Unclassified | 1348 |
| 141 | Ga0466729_106378 | 3300042621 | Bacteria | 2410 |
| 142 | Ga0123357_10293511 | 3300009784 | Bacteria | 1656 |
| 143 | Ga0123355_11785929 | 3300009826 | Unclassified | 581 |
| 144 | Ga0123354_10351499 | 3300010882 | Bacteria | 1313 |
| 145 | 2227467693 | 2225789004 | Bacteria | 5059 |
| 146 | JGI24702J35022_10338667 | 3300002462 | Bacteria | 896 |
| 147 | JGI24699J35502_11134120 | 3300002509 | Bacteria | 33569 |
| 148 | Ga0466707_149826 | 3300042601 | Bacteria | 3724 |
| 149 | Ga0466707_317775 | 3300042601 | Bacteria | 5908 |
| 150 | Ga0466716_378206 | 3300042605 | Bacteria | 16459 |
| 151 | Ga0466705_058615 | 3300042612 | Bacteria | 10341 |
| 152 | Ga0466729_282254 | 3300042621 | Bacteria | 1384 |
| 153 | Ga0466735_086274 | 3300042624 | Bacteria | 9916 |
| 154 | Ga0466735_155495 | 3300042624 | Unclassified | 1419 |
| 155 | Ga0466703_152172 | 3300042636 | Bacteria | 1930 |
| 156 | Ga0466703_170698 | 3300042636 | Unclassified | 1257 |
| 157 | Ga0466704_430910 | 3300042643 | Bacteria | 1647 |
| 158 | Ga0466708_262256 | 3300042652 | Bacteria | 8216 |
| 159 | Ga0466727_124960 | 3300042655 | Bacteria | 13419 |
| 160 | Ga0466692_149299 | 3300042591 | Bacteria | 2004 |
| 161 | Ga0466695_148905 | 3300042595 | Bacteria | 1122 |
| 162 | Ga0466711_338813 | 3300042615 | Bacteria | 6690 |
| 163 | Ga0466715_638688 | 3300042616 | Bacteria | 40279 |
| 164 | Ga0466726_420825 | 3300042619 | Bacteria | 2827 |
| 165 | Ga0123357_10285371 | 3300009784 | Bacteria | 1697 |
| 166 | Ga0123356_12337418 | 3300010049 | Bacteria | 669 |
| 167 | Ga0123353_10109964 | 3300010167 | Bacteria | 4440 |
| 168 | Ga0123353_10500910 | 3300010167 | Bacteria | 1770 |
| 169 | JGI24699J35502_11134014 | 3300002509 | Bacteria | 24334 |
| 170 | Ga0068305_11097550 | 3300005083 | Unclassified | 646 |
| 171 | Ga0123357_10000970 | 3300009784 | Bacteria | 29214 |
| 172 | Ga0466701_083415 | 3300042598 | Bacteria | 1563 |
| 173 | Ga0466700_074515 | 3300042600 | Bacteria | 4295 |
| 174 | Ga0466700_198900 | 3300042600 | Bacteria | 10295 |
| 175 | Ga0466707_112997 | 3300042601 | Bacteria | 12374 |
| 176 | Ga0466722_203823 | 3300042609 | Bacteria | 26562 |
| 177 | Ga0466735_038856 | 3300042624 | Bacteria | 1704 |
| 178 | Ga0466735_065196 | 3300042624 | Bacteria | 1429 |
| 179 | Ga0466703_073309 | 3300042636 | Bacteria | 8476 |
| 180 | Ga0466703_236632 | 3300042636 | Bacteria | 1655 |
| 181 | Ga0466727_142888 | 3300042655 | Unclassified | 3793 |
| 182 | Ga0466691_161179 | 3300042593 | Unclassified | 1082 |
| 183 | Ga0466696_455845 | 3300042596 | Bacteria | 2347 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.