Protein Family IF03089
Metagenome
Isolate
193
Members
102
Samples
162
Scaffolds
416.51
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10042207|Ga0123353_100422074
- Length
- 467 aa
- Sequence
- LQKILAGKINLFLGMWDKKVVFGLKPLNNKKIFYPFNNGNHKIYTVKLKTFILSVIFLLTIFSTNAAYLLIPMDMEQKNHLKAYGIAYFTITKDIDVSWLLNYRGGSFMCVYNAGVEDECVIRGVSYQVIADVQAAAILNEMAATESNMDEVKLTKVPKIAVYSPKNKLPWDDAVTLVLTYAEIPYDVIYDEEVMNDALPKYDWLHVHHEDFTGQYGKFWSNYKNHAWYVEDVKLNEATAAKLGFKKVSQLKLAVAKKIRDFVMGGGYMFAMCSAPDSFDIALAADGVDICDVPFDGDPVEPNAQQKLNYDNCFAFTDFNIVTNPHIYRKSDIDVNPAIHTQNKKNDFFTLFEFSAKWDPVPTMLTQNHQNVIVGFMGQTTAFSNNRIKPHVVILGETKIFDEARYIHGTYGNGTFTFYSGHDPEDYQHFVGDPPTDLNLFPNSPGYRLILNNVLFPAAKKQKQKT*
Sample Types
Isolate
16.1%
Metagenome
83.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Unclassified
24.0%
Formicidae
9.4%
Kalotermitidae
8.3%
Armadillidiidae
5.2%
Culicidae
5.2%
Elmidae
3.1%
Daphniidae
2.1%
Rhinotermitidae
2.1%
Termopsidae
2.1%
Hodotermitidae
1.0%
Nephropidae
1.0%
Apidae
1.0%
Hydrophilidae
1.0%
Passalidae
1.0%
Taxonomy
Archaea
0
Bacteria
177
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 2 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 3 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 12 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 13 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 17 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 18 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 23 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 24 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 25 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 26 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 27 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 30 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 31 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 35 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 36 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 39 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 40 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 41 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 42 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 43 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 48 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 49 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 50 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 51 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 52 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 53 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 54 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 55 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 56 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 57 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 58 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 59 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 60 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 61 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 62 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 63 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 64 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 65 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 66 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 67 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 68 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 69 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 70 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 71 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 72 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 73 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 74 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 75 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 76 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 77 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 78 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 79 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 80 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 81 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 82 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 83 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 84 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 85 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 86 | 2820219087 | Unclassified Ignavibacteria Th196P3bin14 | Isolate | Unclassified |
| 87 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 88 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 89 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 90 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 91 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 92 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 93 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 94 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 95 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 96 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 97 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 98 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 99 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 100 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 101 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 102 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_103016 | 3300042659 | Bacteria | 6307 |
| 2 | Ga0466701_061937 | 3300042598 | Bacteria | 1816 |
| 3 | Ga0466706_065290 | 3300042599 | Bacteria | 12121 |
| 4 | Ga0466707_001681 | 3300042601 | Bacteria | 12758 |
| 5 | Ga0466707_158052 | 3300042601 | Bacteria | 5529 |
| 6 | Ga0466731_211505 | 3300042622 | Bacteria | 3211 |
| 7 | Ga0466731_266903 | 3300042622 | Bacteria | 60514 |
| 8 | Ga0466702_288337 | 3300042635 | Bacteria | 1732 |
| 9 | Ga0466703_407651 | 3300042636 | Bacteria | 5298 |
| 10 | Ga0466704_173397 | 3300042643 | Bacteria | 4688 |
| 11 | Ga0466709_083595 | 3300042648 | Bacteria | 26100 |
| 12 | Ga0466710_283268 | 3300042613 | Bacteria | 2466 |
| 13 | Ga0123355_10000161 | 3300009826 | Bacteria | 81946 |
| 14 | Ga0123356_10034598 | 3300010049 | Bacteria | 4722 |
| 15 | Ga0123353_10001557 | 3300010167 | Bacteria | 28122 |
| 16 | Ga0123353_10042207 | 3300010167 | Bacteria | 7212 |
| 17 | Ga0160433_100032 | 3300012846 | Bacteria | 165473 |
| 18 | Ga0264413_105305 | 3300024493 | Bacteria | 15609 |
| 19 | Ga0415639_270234 | 3300038395 | Bacteria | 1232 |
| 20 | Ga0466690_173926 | 3300042590 | Unclassified | 6566 |
| 21 | Ga0466696_455700 | 3300042596 | Bacteria | 12920 |
| 22 | AustNasuHG_c1003134 | 3300000089 | Bacteria | 5963 |
| 23 | JGI24702J35022_10016240 | 3300002462 | Bacteria | 4082 |
| 24 | JGI24702J35022_10061252 | 3300002462 | Bacteria | 2013 |
| 25 | Ga0072941_1006410 | 3300005201 | Unclassified | 17131 |
| 26 | Ga0103265_1000697 | 3300007068 | Bacteria | 5583 |
| 27 | Ga0466701_100742 | 3300042598 | Bacteria | 6223 |
| 28 | Ga0466700_037350 | 3300042600 | Bacteria | 11942 |
| 29 | Ga0466713_041543 | 3300042602 | Bacteria | 8044 |
| 30 | Ga0466731_359950 | 3300042622 | Bacteria | 2236 |
| 31 | Ga0466712_088280 | 3300042614 | Bacteria | 3385 |
| 32 | Ga0466715_382018 | 3300042616 | Unclassified | 23228 |
| 33 | Ga0466729_191748 | 3300042621 | Bacteria | 8466 |
| 34 | Ga0123356_10022648 | 3300010049 | Bacteria | 5927 |
| 35 | Ga0123356_10039577 | 3300010049 | Unclassified | 4392 |
| 36 | Ga0123353_10011313 | 3300010167 | Bacteria | 12558 |
| 37 | Ga0123353_10089038 | 3300010167 | Bacteria | 4970 |
| 38 | Ga0123354_10233665 | 3300010882 | Bacteria | 1914 |
| 39 | Ga0466696_002758 | 3300042596 | Bacteria | 19389 |
| 40 | Ga0102737_1000040 | 3300007142 | Bacteria | 38273 |
| 41 | Ga0103268_1000990 | 3300007192 | Unclassified | 7611 |
| 42 | Ga0466701_098317 | 3300042598 | Bacteria | 8150 |
| 43 | Ga0466706_118402 | 3300042599 | Bacteria | 2271 |
| 44 | Ga0466722_057211 | 3300042609 | Bacteria | 2236 |
| 45 | Ga0466702_409512 | 3300042635 | Bacteria | 1233 |
| 46 | Ga0466710_439552 | 3300042613 | Bacteria | 6063 |
| 47 | Ga0466710_455812 | 3300042613 | Bacteria | 3902 |
| 48 | Ga0466712_032554 | 3300042614 | Bacteria | 10285 |
| 49 | Ga0123353_10000425 | 3300010167 | Bacteria | 52261 |
| 50 | Ga0123353_10008800 | 3300010167 | Bacteria | 13833 |
| 51 | Ga0466695_129296 | 3300042595 | Bacteria | 21897 |
| 52 | IMNBL1DRAFT_c0002975 | 3300000062 | Bacteria | 11257 |
| 53 | Ga0068305_10046751 | 3300005083 | Bacteria | 29879 |
| 54 | Ga0102739_1000017 | 3300007095 | Bacteria | 58340 |
| 55 | Ga0466732_130254 | 3300042656 | Bacteria | 2675 |
| 56 | Ga0466732_177137 | 3300042656 | Bacteria | 1534 |
| 57 | Ga0466732_384759 | 3300042656 | Bacteria | 2158 |
| 58 | Ga0466706_051635 | 3300042599 | Bacteria | 8362 |
| 59 | Ga0466707_293694 | 3300042601 | Unclassified | 3829 |
| 60 | Ga0466713_057198 | 3300042602 | Bacteria | 57543 |
| 61 | Ga0466714_058710 | 3300042603 | Bacteria | 109931 |
| 62 | Ga0466708_409937 | 3300042652 | Bacteria | 4046 |
| 63 | Ga0466718_105114 | 3300042617 | Bacteria | 13621 |
| 64 | Ga0466726_280749 | 3300042619 | Bacteria | 3900 |
| 65 | Ga0123356_10000992 | 3300010049 | Bacteria | 31515 |
| 66 | Ga0123356_10024324 | 3300010049 | Bacteria | 5701 |
| 67 | Ga0123354_10048710 | 3300010882 | Unclassified | 6438 |
| 68 | Ga0160441_100013 | 3300012825 | Bacteria | 353830 |
| 69 | Ga0160435_1000005 | 3300012857 | Bacteria | 359635 |
| 70 | Ga0415639_042366 | 3300038395 | Bacteria | 12021 |
| 71 | Ga0415639_054987 | 3300038395 | Bacteria | 4096 |
| 72 | Ga0466656_227258 | 3300042550 | Bacteria | 2611 |
| 73 | Ga0466657_289518 | 3300042582 | Bacteria | 4298 |
| 74 | JGI24696J40584_12961524 | 3300002834 | Bacteria | 19637 |
| 75 | Ga0466732_041734 | 3300042656 | Bacteria | 75299 |
| 76 | Ga0466706_165084 | 3300042599 | Bacteria | 195712 |
| 77 | Ga0466707_021774 | 3300042601 | Bacteria | 6918 |
| 78 | Ga0466714_010671 | 3300042603 | Bacteria | 2535 |
| 79 | Ga0466717_306322 | 3300042604 | Unclassified | 2254 |
| 80 | Ga0466720_068655 | 3300042607 | Bacteria | 12399 |
| 81 | Ga0466697_006762 | 3300042611 | Bacteria | 2706 |
| 82 | Ga0466735_022680 | 3300042624 | Bacteria | 5600 |
| 83 | Ga0466709_098402 | 3300042648 | Bacteria | 118141 |
| 84 | Ga0466724_00778 | 3300042649 | Bacteria | 5292 |
| 85 | Ga0466712_270085 | 3300042614 | Bacteria | 1812 |
| 86 | Ga0466729_122349 | 3300042621 | Bacteria | 2049 |
| 87 | Ga0123356_10001642 | 3300010049 | Bacteria | 24549 |
| 88 | Ga0123353_10000048 | 3300010167 | Bacteria | 132187 |
| 89 | Ga0415639_043885 | 3300038395 | Bacteria | 2972 |
| 90 | JGI24695J34938_10000249 | 3300002450 | Bacteria | 52020 |
| 91 | JGI24696J40584_12960459 | 3300002834 | Bacteria | 7300 |
| 92 | Ga0072940_1013756 | 3300005200 | Bacteria | 6388 |
| 93 | Ga0072941_1022743 | 3300005201 | Bacteria | 11065 |
| 94 | Ga0102735_1000198 | 3300007080 | Unclassified | 15380 |
| 95 | Ga0102734_1000079 | 3300007129 | Bacteria | 54104 |
| 96 | Ga0103267_1005462 | 3300007190 | Bacteria | 3553 |
| 97 | Ga0466713_010765 | 3300042602 | Bacteria | 37272 |
| 98 | Ga0466713_070245 | 3300042602 | Bacteria | 20718 |
| 99 | Ga0466714_025262 | 3300042603 | Bacteria | 3458 |
| 100 | Ga0466731_012393 | 3300042622 | Bacteria | 11846 |
| 101 | Ga0466735_127798 | 3300042624 | Bacteria | 4067 |
| 102 | Ga0466702_301303 | 3300042635 | Unclassified | 1496 |
| 103 | Ga0466709_180467 | 3300042648 | Bacteria | 40114 |
| 104 | Ga0466715_378211 | 3300042616 | Bacteria | 1987 |
| 105 | Ga0466723_330665 | 3300042618 | Bacteria | 10340 |
| 106 | Ga0123356_10022039 | 3300010049 | Bacteria | 6015 |
| 107 | Ga0123356_10064122 | 3300010049 | Bacteria | 3434 |
| 108 | Ga0123353_10003772 | 3300010167 | Unclassified | 19302 |
| 109 | Ga0123353_10026406 | 3300010167 | Bacteria | 8869 |
| 110 | Ga0123353_10063692 | 3300010167 | Bacteria | 5914 |
| 111 | Ga0123353_10384179 | 3300010167 | Bacteria | 2098 |
| 112 | Ga0160455_100412 | 3300012837 | Bacteria | 23367 |
| 113 | Ga0160472_100761 | 3300012839 | Unclassified | 14340 |
| 114 | Ga0160434_100238 | 3300012850 | Bacteria | 23270 |
| 115 | Ga0466694_150704 | 3300042594 | Bacteria | 1721 |
| 116 | Ga0466696_311000 | 3300042596 | Bacteria | 2054 |
| 117 | Ga0466699_351928 | 3300042597 | Bacteria | 2779 |
| 118 | JGI24698J34947_10008697 | 3300002449 | Bacteria | 5568 |
| 119 | JGI24702J35022_10001141 | 3300002462 | Bacteria | 16511 |
| 120 | Ga0103267_1001946 | 3300007190 | Unclassified | 10724 |
| 121 | Ga0466697_081097 | 3300042611 | Bacteria | 3168 |
| 122 | Ga0466720_060162 | 3300042607 | Bacteria | 5160 |
| 123 | Ga0466720_175826 | 3300042607 | Bacteria | 1641 |
| 124 | Ga0466720_177014 | 3300042607 | Bacteria | 27521 |
| 125 | Ga0466734_105676 | 3300042623 | Bacteria | 2582 |
| 126 | Ga0466702_048934 | 3300042635 | Bacteria | 5554 |
| 127 | Ga0466703_385315 | 3300042636 | Bacteria | 3694 |
| 128 | Ga0466718_134283 | 3300042617 | Bacteria | 6839 |
| 129 | Ga0123356_10000436 | 3300010049 | Bacteria | 47690 |
| 130 | Ga0123353_10022792 | 3300010167 | Bacteria | 9457 |
| 131 | Ga0123353_10240659 | 3300010167 | Bacteria | 2812 |
| 132 | Ga0160469_100154 | 3300012824 | Bacteria | 76254 |
| 133 | Ga0160460_100068 | 3300012845 | Bacteria | 160857 |
| 134 | Ga0160443_100413 | 3300012848 | Bacteria | 33783 |
| 135 | Ga0160457_1001100 | 3300012858 | Bacteria | 8439 |
| 136 | Ga0264413_105306 | 3300024493 | Unclassified | 11576 |
| 137 | Ga0415639_043852 | 3300038395 | Bacteria | 1348 |
| 138 | JGI24695J34938_10003105 | 3300002450 | Bacteria | 11870 |
| 139 | JGI24702J35022_10146271 | 3300002462 | Bacteria | 1323 |
| 140 | CVPL010W_10000627 | 3300002931 | Bacteria | 40635 |
| 141 | Ga0072941_1048112 | 3300005201 | Bacteria | 14724 |
| 142 | Ga0072941_1073869 | 3300005201 | Unclassified | 4241 |
| 143 | Ga0466732_036404 | 3300042656 | Bacteria | 5188 |
| 144 | Ga0466706_286100 | 3300042599 | Bacteria | 13496 |
| 145 | Ga0466700_362509 | 3300042600 | Bacteria | 109813 |
| 146 | Ga0466717_009727 | 3300042604 | Bacteria | 1571 |
| 147 | Ga0466721_144068 | 3300042608 | Bacteria | 24041 |
| 148 | Ga0466731_179773 | 3300042622 | Bacteria | 5407 |
| 149 | Ga0466735_027194 | 3300042624 | Bacteria | 14165 |
| 150 | Ga0466710_030848 | 3300042613 | Bacteria | 9015 |
| 151 | Ga0123356_10015725 | 3300010049 | Bacteria | 7242 |
| 152 | Ga0123353_10003378 | 3300010167 | Bacteria | 20169 |
| 153 | Ga0123354_10034812 | 3300010882 | Bacteria | 7872 |
| 154 | Ga0123354_10218825 | 3300010882 | Unclassified | 2031 |
| 155 | Ga0160465_100054 | 3300012803 | Bacteria | 130977 |
| 156 | Ga0160470_100043 | 3300012813 | Bacteria | 189187 |
| 157 | Ga0264413_156359 | 3300024493 | Bacteria | 2732 |
| 158 | Ga0415639_001954 | 3300038395 | Bacteria | 43278 |
| 159 | Ga0466694_201329 | 3300042594 | Bacteria | 7813 |
| 160 | Ga0072941_1000967 | 3300005201 | Bacteria | 66192 |
| 161 | Ga0072941_1511487 | 3300005201 | Bacteria | 2439 |
| 162 | Ga0102740_1000163 | 3300007140 | Bacteria | 18409 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.