Protein Family IF03079
Metagenome
Isolate
149
Members
74
Samples
130
Scaffolds
247.93
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10026795|Ga0123353_100267959
- Length
- 291 aa
- Sequence
- LIRIRVAGAYPKIEICEFFDYSPRSRQNIPTFDAEHRQSLRILMTDLALTALVTGGSRGIGKCIAQALGTRGYQVYLTYVSKPTEAEAVADSINAAGGKARAFKLNVGDAASVSAFFQDEIKDKVHLGLLVNNAGITKDGFMIRMKDEDFDAVVDINLKGAFRCLREAAKIMSRQRSGRIVNIASVVGQMGNAGQVNYSAAKAGLIGMTKSAAKELAGRGITVNAVAPGFIETDMTSALSEEVREQYLEHIPLKRFGTAEDVAEAVAFLASDKAGYITGQILAVNGGMYC*
Sample Types
Isolate
12.8%
Metagenome
87.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Unclassified
22.2%
Kalotermitidae
19.4%
Rhinotermitidae
5.6%
Formicidae
4.2%
Termopsidae
4.2%
Passalidae
2.8%
Hydrophilidae
2.8%
Scarabaeidae
1.4%
Elmidae
1.4%
Blattidae
1.4%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
141
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 2 | 2820058318 | Unclassified Proteobacteria Nt197P4bin33 | Isolate | Unclassified |
| 3 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 4 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 5 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 16 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 23 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 24 | 2820072841 | Unclassified Proteobacteria Nt197P3bin127 | Isolate | Unclassified |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 2820946191 | Unclassified Acidobacteria Nt197P3bin31 | Isolate | Unclassified |
| 29 | 2861449170 | Desulfovibrio intestinalis DSM 11275 | Isolate | Unclassified |
| 30 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 31 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 32 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 35 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 40 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 41 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 42 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 49 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 50 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 51 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 52 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 53 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 54 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 55 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 56 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 57 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 58 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 59 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 60 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 61 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 62 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 63 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 64 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 65 | 2772190890 | Unclassified Elusimicrobia Lab288P4_bin46 | Isolate | Unclassified |
| 66 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 67 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 68 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 69 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 70 | 2820459456 | Unclassified Firmicutes Lab288P3bin148 | Isolate | Unclassified |
| 71 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 72 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 73 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 74 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10011312 | 3300009784 | Bacteria | 11430 |
| 2 | Ga0466710_353301 | 3300042613 | Bacteria | 1451 |
| 3 | Ga0466718_167958 | 3300042617 | Unclassified | 2687 |
| 4 | Ga0466726_310770 | 3300042619 | Bacteria | 2900 |
| 5 | Ga0466729_079038 | 3300042621 | Bacteria | 9279 |
| 6 | Ga0466706_066405 | 3300042599 | Bacteria | 6113 |
| 7 | Ga0466707_207665 | 3300042601 | Bacteria | 2904 |
| 8 | Ga0466722_012582 | 3300042609 | Bacteria | 26402 |
| 9 | Ga0466727_151432 | 3300042655 | Bacteria | 242508 |
| 10 | Ga0466718_129747 | 3300042617 | Bacteria | 2405 |
| 11 | Ga0466726_236984 | 3300042619 | Bacteria | 1935 |
| 12 | Ga0466728_406861 | 3300042620 | Bacteria | 1604 |
| 13 | Ga0466700_262383 | 3300042600 | Bacteria | 9190 |
| 14 | Ga0466716_209741 | 3300042605 | Bacteria | 61370 |
| 15 | Ga0466720_038224 | 3300042607 | Bacteria | 5660 |
| 16 | Ga0466690_373341 | 3300042590 | Bacteria | 47139 |
| 17 | Ga0466699_351202 | 3300042597 | Bacteria | 5006 |
| 18 | Ga0466731_043615 | 3300042622 | Bacteria | 2722 |
| 19 | Ga0466702_014074 | 3300042635 | Bacteria | 1407 |
| 20 | Ga0466703_265498 | 3300042636 | Bacteria | 5619 |
| 21 | Ga0466704_040833 | 3300042643 | Bacteria | 26578 |
| 22 | Ga0466708_232353 | 3300042652 | Bacteria | 129711 |
| 23 | Ga0074263_110869 | 3300005485 | Unclassified | 1666 |
| 24 | Ga0103264_1002810 | 3300007188 | Bacteria | 15114 |
| 25 | Ga0103268_1000880 | 3300007192 | Bacteria | 8312 |
| 26 | Ga0123357_10187911 | 3300009784 | Bacteria | 2390 |
| 27 | Ga0466723_227921 | 3300042618 | Bacteria | 2011 |
| 28 | Ga0466726_130069 | 3300042619 | Bacteria | 1106 |
| 29 | Ga0466713_107228 | 3300042602 | Bacteria | 27681 |
| 30 | Ga0415639_130449 | 3300038395 | Unclassified | 7845 |
| 31 | Ga0466693_426044 | 3300042592 | Bacteria | 2095 |
| 32 | Ga0466699_242261 | 3300042597 | Bacteria | 3176 |
| 33 | Ga0466734_158609 | 3300042623 | Bacteria | 2596 |
| 34 | Ga0466735_015321 | 3300042624 | Bacteria | 42913 |
| 35 | Ga0466704_283529 | 3300042643 | Unclassified | 5965 |
| 36 | Ga0466704_429063 | 3300042643 | Bacteria | 1375 |
| 37 | Ga0466709_181912 | 3300042648 | Bacteria | 10443 |
| 38 | Ga0466709_192005 | 3300042648 | Bacteria | 1231 |
| 39 | Ga0466708_406526 | 3300042652 | Bacteria | 66629 |
| 40 | JGI24702J35022_10025113 | 3300002462 | Bacteria | 3217 |
| 41 | Ga0123356_11186742 | 3300010049 | Bacteria | 930 |
| 42 | Ga0466711_068854 | 3300042615 | Bacteria | 4925 |
| 43 | Ga0466711_338911 | 3300042615 | Bacteria | 3825 |
| 44 | Ga0466715_476582 | 3300042616 | Bacteria | 40281 |
| 45 | Ga0466718_034030 | 3300042617 | Bacteria | 3003 |
| 46 | Ga0466723_259748 | 3300042618 | Bacteria | 40517 |
| 47 | Ga0466729_082034 | 3300042621 | Bacteria | 4693 |
| 48 | Ga0466707_077679 | 3300042601 | Bacteria | 32224 |
| 49 | Ga0466719_459024 | 3300042606 | Bacteria | 1316 |
| 50 | Ga0415639_053832 | 3300038395 | Bacteria | 7007 |
| 51 | Ga0466694_067082 | 3300042594 | Bacteria | 1121 |
| 52 | Ga0466696_403247 | 3300042596 | Bacteria | 2992 |
| 53 | Ga0466703_306697 | 3300042636 | Bacteria | 1153 |
| 54 | Ga0466709_050803 | 3300042648 | Bacteria | 6568 |
| 55 | Ga0466709_143221 | 3300042648 | Bacteria | 1507 |
| 56 | Ga0466725_079004 | 3300042654 | Bacteria | 2489 |
| 57 | Ga0466727_172486 | 3300042655 | Bacteria | 14463 |
| 58 | JGI24702J35022_10078540 | 3300002462 | Bacteria | 1786 |
| 59 | Ga0072940_1079323 | 3300005200 | Bacteria | 3882 |
| 60 | Ga0123356_10205337 | 3300010049 | Bacteria | 2014 |
| 61 | Ga0123356_10629479 | 3300010049 | Bacteria | 1239 |
| 62 | Ga0466705_463022 | 3300042612 | Bacteria | 12650 |
| 63 | Ga0466711_246643 | 3300042615 | Bacteria | 90615 |
| 64 | Ga0466711_405813 | 3300042615 | Bacteria | 65237 |
| 65 | Ga0466718_045534 | 3300042617 | Bacteria | 2647 |
| 66 | Ga0466718_153511 | 3300042617 | Bacteria | 10989 |
| 67 | Ga0466726_038670 | 3300042619 | Bacteria | 6454 |
| 68 | Ga0466726_378689 | 3300042619 | Bacteria | 30171 |
| 69 | Ga0466729_063894 | 3300042621 | Bacteria | 42113 |
| 70 | Ga0466706_006070 | 3300042599 | Bacteria | 30188 |
| 71 | Ga0466706_280382 | 3300042599 | Bacteria | 16803 |
| 72 | Ga0466716_031956 | 3300042605 | Bacteria | 14772 |
| 73 | Ga0466720_131891 | 3300042607 | Unclassified | 21184 |
| 74 | Ga0415639_095123 | 3300038395 | Bacteria | 5227 |
| 75 | Ga0466691_087525 | 3300042593 | Bacteria | 17995 |
| 76 | Ga0466735_054350 | 3300042624 | Bacteria | 4284 |
| 77 | Ga0466703_250320 | 3300042636 | Bacteria | 592480 |
| 78 | IMNBL1DRAFT_c0048912 | 3300000062 | Bacteria | 1352 |
| 79 | JGI24698J34947_10000713 | 3300002449 | Bacteria | 16306 |
| 80 | Ga0103264_1000692 | 3300007188 | Bacteria | 26429 |
| 81 | Ga0466705_029461 | 3300042612 | Bacteria | 10579 |
| 82 | Ga0123357_10016503 | 3300009784 | Bacteria | 9721 |
| 83 | Ga0123357_10132333 | 3300009784 | Bacteria | 3100 |
| 84 | Ga0160465_102428 | 3300012803 | Bacteria | 4114 |
| 85 | Ga0466718_125607 | 3300042617 | Unclassified | 3881 |
| 86 | Ga0466718_144770 | 3300042617 | Bacteria | 1432 |
| 87 | Ga0466726_466767 | 3300042619 | Bacteria | 2098 |
| 88 | Ga0466728_197039 | 3300042620 | Bacteria | 33942 |
| 89 | Ga0466707_232879 | 3300042601 | Bacteria | 17799 |
| 90 | Ga0466722_165909 | 3300042609 | Bacteria | 17829 |
| 91 | Ga0466692_199861 | 3300042591 | Bacteria | 1601 |
| 92 | Ga0466727_243843 | 3300042655 | Bacteria | 14390 |
| 93 | Ga0072941_1336330 | 3300005201 | Bacteria | 1866 |
| 94 | Ga0466705_270900 | 3300042612 | Bacteria | 1661 |
| 95 | Ga0123355_10156744 | 3300009826 | Bacteria | 3442 |
| 96 | Ga0123353_10062650 | 3300010167 | Bacteria | 5965 |
| 97 | Ga0123353_10254518 | 3300010167 | Bacteria | 2717 |
| 98 | Ga0123354_10000055 | 3300010882 | Unclassified | 84713 |
| 99 | Ga0466712_319343 | 3300042614 | Bacteria | 1637 |
| 100 | Ga0466711_077484 | 3300042615 | Bacteria | 2582 |
| 101 | Ga0466711_289188 | 3300042615 | Bacteria | 3102 |
| 102 | Ga0466718_079594 | 3300042617 | Bacteria | 1552 |
| 103 | Ga0466707_377447 | 3300042601 | Bacteria | 7575 |
| 104 | Ga0466722_046433 | 3300042609 | Bacteria | 5635 |
| 105 | Ga0466691_009026 | 3300042593 | Bacteria | 1550 |
| 106 | Ga0466694_091982 | 3300042594 | Bacteria | 1550 |
| 107 | Ga0466699_041162 | 3300042597 | Bacteria | 7411 |
| 108 | Ga0466699_240232 | 3300042597 | Bacteria | 4579 |
| 109 | IMNBL1DRAFT_c0048970 | 3300000062 | Bacteria | 1351 |
| 110 | Ga0068305_10049659 | 3300005083 | Bacteria | 13625 |
| 111 | Ga0466705_141361 | 3300042612 | Bacteria | 22643 |
| 112 | Ga0466705_257501 | 3300042612 | Bacteria | 57239 |
| 113 | Ga0123353_10026795 | 3300010167 | Bacteria | 8813 |
| 114 | Ga0466711_044341 | 3300042615 | Bacteria | 37002 |
| 115 | Ga0466718_126338 | 3300042617 | Unclassified | 2832 |
| 116 | Ga0466728_082550 | 3300042620 | Bacteria | 55139 |
| 117 | Ga0466706_148775 | 3300042599 | Bacteria | 10907 |
| 118 | Ga0466706_165951 | 3300042599 | Bacteria | 2889 |
| 119 | Ga0466707_311468 | 3300042601 | Bacteria | 20339 |
| 120 | Ga0466713_035883 | 3300042602 | Bacteria | 47545 |
| 121 | Ga0466714_132568 | 3300042603 | Bacteria | 4788 |
| 122 | Ga0466719_527379 | 3300042606 | Bacteria | 121423 |
| 123 | Ga0466694_072219 | 3300042594 | Bacteria | 4329 |
| 124 | Ga0466704_615317 | 3300042643 | Bacteria | 4074 |
| 125 | Ga0466708_430922 | 3300042652 | Bacteria | 4097 |
| 126 | Ga0466725_446514 | 3300042654 | Bacteria | 2344 |
| 127 | 2227514108 | 2225789004 | Bacteria | 3485 |
| 128 | JGI24705J35276_12227879 | 3300002504 | Bacteria | 3082 |
| 129 | Ga0072941_1192062 | 3300005201 | Bacteria | 2791 |
| 130 | Ga0102736_1001140 | 3300007052 | Bacteria | 9435 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.