Protein Family IF03042
Metagenome
Isolate
150
Members
64
Samples
134
Scaffolds
257.69
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10003138|Ga0123353_1000313810
- Length
- 290 aa
- Sequence
- LTEEIQETEVDSQGRRFPDNQALKLWNVCRRSSMIQIRTREEIEIIRENNLLVSATLAEVGKHVKPGVTTRMLDQIAEEYIRAHGAEPGFLGHRGFPATLCVSVNEQVVHGIPSDYVLKEGDVVSVDCGTIMKGFYGDSAYTFAVGQIAVPVAGLLQVTREALYKGVAQARAGNRVGDISAAVQEHVESHGFSVVRELVGHGLGRKMHESPEVPNFGLRGRGPLLREGMVICIEPMVNMGGKQVVFEKDGWTVRTKDRQPSAHYEFAVAVGKEGPDVLTDFTVIERAIN*
Sample Types
Isolate
10.7%
Metagenome
89.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.4%
Unclassified
26.2%
Kalotermitidae
16.4%
Rhinotermitidae
4.9%
Termopsidae
4.9%
Passalidae
4.9%
Tenebrionidae
3.3%
Hodotermitidae
1.6%
Formicidae
1.6%
Drosophilidae
1.6%
Taxonomy
Archaea
0
Bacteria
145
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2791354849 | Unclassified Chloroflexi Lab288P3bin29 | Isolate | Unclassified |
| 2 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 2791354848 | Unclassified Chloroflexi Emb289P3bin155 | Isolate | Unclassified |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 16 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 19 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 23 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 27 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 28 | 2820422691 | Unclassified Firmicutes Lab288P3bin58 | Isolate | Unclassified |
| 29 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 33 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 34 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 35 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 40 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 41 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 42 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 43 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 50 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 51 | 2820729191 | Unclassified Chloroflexi Th196P4bin49 | Isolate | Unclassified |
| 52 | 2820731983 | Unclassified Chloroflexi Nt197P3bin126 | Isolate | Unclassified |
| 53 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 55 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 56 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 57 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 58 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 59 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 60 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 61 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 62 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 63 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 64 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_000945 | 3300042659 | Bacteria | 2328 |
| 2 | Ga0265387_1000159 | 3300024582 | Bacteria | 12397 |
| 3 | Ga0466714_132072 | 3300042603 | Bacteria | 14433 |
| 4 | Ga0466705_036550 | 3300042612 | Bacteria | 1769 |
| 5 | Ga0466735_145556 | 3300042624 | Bacteria | 6985 |
| 6 | Ga0466703_093625 | 3300042636 | Unclassified | 4650 |
| 7 | Ga0466703_099949 | 3300042636 | Unclassified | 2057 |
| 8 | Ga0466727_316709 | 3300042655 | Bacteria | 34486 |
| 9 | Ga0466710_214328 | 3300042613 | Bacteria | 1000 |
| 10 | Ga0466726_240361 | 3300042619 | Bacteria | 4991 |
| 11 | Ga0123356_10025301 | 3300010049 | Bacteria | 5581 |
| 12 | Ga0123353_10054737 | 3300010167 | Bacteria | 6382 |
| 13 | Ga0123354_10468491 | 3300010882 | Bacteria | 1006 |
| 14 | Ga0466732_324498 | 3300042656 | Bacteria | 5229 |
| 15 | Ga0466733_058408 | 3300042659 | Bacteria | 3573 |
| 16 | Ga0562376_6173 | 3300056857 | Bacteria | 5927 |
| 17 | Ga0466692_120097 | 3300042591 | Bacteria | 76506 |
| 18 | Ga0466706_240769 | 3300042599 | Unclassified | 1496 |
| 19 | Ga0466700_244408 | 3300042600 | Bacteria | 3137 |
| 20 | Ga0466707_311653 | 3300042601 | Bacteria | 12538 |
| 21 | Ga0466707_354355 | 3300042601 | Bacteria | 49155 |
| 22 | Ga0466713_137191 | 3300042602 | Bacteria | 44160 |
| 23 | Ga0466714_055399 | 3300042603 | Bacteria | 1848 |
| 24 | Ga0466705_146538 | 3300042612 | Bacteria | 158344 |
| 25 | Ga0466708_134998 | 3300042652 | Bacteria | 4614 |
| 26 | JGI24702J35022_10012553 | 3300002462 | Unclassified | 4704 |
| 27 | JGI24702J35022_10354625 | 3300002462 | Bacteria | 877 |
| 28 | Ga0068305_10077824 | 3300005083 | Bacteria | 15891 |
| 29 | Ga0466726_071080 | 3300042619 | Bacteria | 11944 |
| 30 | Ga0466729_053410 | 3300042621 | Bacteria | 50114 |
| 31 | Ga0123355_10036198 | 3300009826 | Bacteria | 8026 |
| 32 | Ga0123356_10007090 | 3300010049 | Bacteria | 11233 |
| 33 | Ga0123353_10111816 | 3300010167 | Unclassified | 4399 |
| 34 | Ga0466732_102290 | 3300042656 | Bacteria | 1381 |
| 35 | Ga0562375_0042 | 3300056856 | Bacteria | 527811 |
| 36 | Ga0466694_124646 | 3300042594 | Bacteria | 1167 |
| 37 | Ga0466706_013322 | 3300042599 | Bacteria | 22899 |
| 38 | Ga0466706_186042 | 3300042599 | Bacteria | 6626 |
| 39 | Ga0466713_050362 | 3300042602 | Bacteria | 1200 |
| 40 | Ga0466713_100727 | 3300042602 | Bacteria | 5067 |
| 41 | Ga0466714_053981 | 3300042603 | Bacteria | 7171 |
| 42 | Ga0466697_273416 | 3300042611 | Bacteria | 5101 |
| 43 | IMNBL1DRAFT_c0005235 | 3300000062 | Bacteria | 7488 |
| 44 | JGI24702J35022_10075285 | 3300002462 | Bacteria | 1823 |
| 45 | Ga0104041_1000591 | 3300007106 | Bacteria | 3667 |
| 46 | Ga0466711_008894 | 3300042615 | Bacteria | 16611 |
| 47 | Ga0466711_141717 | 3300042615 | Bacteria | 15726 |
| 48 | Ga0466715_176752 | 3300042616 | Bacteria | 9889 |
| 49 | Ga0123356_10797964 | 3300010049 | Bacteria | 1115 |
| 50 | Ga0123353_10000019 | 3300010167 | Bacteria | 185006 |
| 51 | Ga0123353_10345727 | 3300010167 | Bacteria | 2244 |
| 52 | Ga0466733_090216 | 3300042659 | Bacteria | 6126 |
| 53 | Ga0466733_155816 | 3300042659 | Bacteria | 13838 |
| 54 | Ga0466733_181532 | 3300042659 | Bacteria | 2205 |
| 55 | Ga0466694_254155 | 3300042594 | Bacteria | 1308 |
| 56 | Ga0466696_255812 | 3300042596 | Bacteria | 4067 |
| 57 | Ga0466696_396970 | 3300042596 | Bacteria | 18436 |
| 58 | Ga0466700_197020 | 3300042600 | Bacteria | 1264 |
| 59 | Ga0466713_052484 | 3300042602 | Bacteria | 51192 |
| 60 | Ga0466714_063295 | 3300042603 | Bacteria | 11290 |
| 61 | Ga0466722_035372 | 3300042609 | Bacteria | 7656 |
| 62 | Ga0466697_154536 | 3300042611 | Bacteria | 6155 |
| 63 | Ga0466703_144740 | 3300042636 | Bacteria | 4361 |
| 64 | Ga0466708_151421 | 3300042652 | Bacteria | 8733 |
| 65 | IMNBL1DRAFT_c0000511 | 3300000062 | Bacteria | 31936 |
| 66 | Ga0103263_103070 | 3300007042 | Bacteria | 2019 |
| 67 | Ga0466715_327374 | 3300042616 | Bacteria | 3086 |
| 68 | Ga0123357_10023310 | 3300009784 | Bacteria | 8316 |
| 69 | Ga0123356_10001427 | 3300010049 | Bacteria | 26432 |
| 70 | Ga0123356_10015115 | 3300010049 | Bacteria | 7402 |
| 71 | Ga0466695_082200 | 3300042595 | Bacteria | 5554 |
| 72 | Ga0466706_103986 | 3300042599 | Bacteria | 16586 |
| 73 | Ga0466706_228754 | 3300042599 | Bacteria | 25710 |
| 74 | Ga0466714_090728 | 3300042603 | Bacteria | 1000 |
| 75 | Ga0466714_093767 | 3300042603 | Bacteria | 1391 |
| 76 | Ga0466716_126809 | 3300042605 | Bacteria | 9806 |
| 77 | Ga0466722_030131 | 3300042609 | Bacteria | 3000 |
| 78 | Ga0466703_094105 | 3300042636 | Bacteria | 1140 |
| 79 | Ga0466704_246878 | 3300042643 | Bacteria | 1252 |
| 80 | JGI24702J35022_10001355 | 3300002462 | Bacteria | 15206 |
| 81 | Ga0466728_035321 | 3300042620 | Bacteria | 8591 |
| 82 | Ga0123357_10107751 | 3300009784 | Bacteria | 3567 |
| 83 | Ga0123355_10229205 | 3300009826 | Bacteria | 2656 |
| 84 | Ga0123356_10004963 | 3300010049 | Bacteria | 13641 |
| 85 | Ga0123353_10003138 | 3300010167 | Bacteria | 20743 |
| 86 | Ga0466733_031543 | 3300042659 | Bacteria | 31583 |
| 87 | Ga0466733_127261 | 3300042659 | Bacteria | 9314 |
| 88 | Ga0265387_1000894 | 3300024582 | Bacteria | 4515 |
| 89 | Ga0466693_043677 | 3300042592 | Bacteria | 1792 |
| 90 | Ga0466693_202182 | 3300042592 | Bacteria | 1619 |
| 91 | Ga0466713_049715 | 3300042602 | Bacteria | 11154 |
| 92 | Ga0466714_103426 | 3300042603 | Bacteria | 1763 |
| 93 | Ga0466714_114034 | 3300042603 | Bacteria | 2158 |
| 94 | Ga0466721_160541 | 3300042608 | Bacteria | 27628 |
| 95 | Ga0466722_261327 | 3300042609 | Bacteria | 19029 |
| 96 | Ga0466698_082575 | 3300042610 | Bacteria | 1750 |
| 97 | Ga0466697_191671 | 3300042611 | Bacteria | 7258 |
| 98 | Ga0466705_058835 | 3300042612 | Bacteria | 18299 |
| 99 | Ga0466735_043703 | 3300042624 | Bacteria | 36972 |
| 100 | Ga0466735_114961 | 3300042624 | Bacteria | 12299 |
| 101 | 2227078583 | 2225789003 | Bacteria | 2090 |
| 102 | 2227480509 | 2225789004 | Bacteria | 4448 |
| 103 | 2227507944 | 2225789004 | Bacteria | 72999 |
| 104 | IMNBL1DRAFT_c0026259 | 3300000062 | Bacteria | 2216 |
| 105 | JGI24705J35276_12232563 | 3300002504 | Bacteria | 4385 |
| 106 | Ga0072941_1428514 | 3300005201 | Bacteria | 2313 |
| 107 | Ga0123353_10006555 | 3300010167 | Bacteria | 15522 |
| 108 | Ga0123353_10666628 | 3300010167 | Bacteria | 1469 |
| 109 | Ga0466706_014133 | 3300042599 | Bacteria | 19194 |
| 110 | Ga0466714_031947 | 3300042603 | Bacteria | 1211 |
| 111 | Ga0466714_044856 | 3300042603 | Bacteria | 1339 |
| 112 | Ga0466714_064677 | 3300042603 | Bacteria | 1203 |
| 113 | Ga0466714_082590 | 3300042603 | Bacteria | 1963 |
| 114 | Ga0466714_094091 | 3300042603 | Bacteria | 2687 |
| 115 | Ga0466714_094171 | 3300042603 | Bacteria | 3500 |
| 116 | Ga0466703_317271 | 3300042636 | Bacteria | 2425 |
| 117 | Ga0466708_137425 | 3300042652 | Bacteria | 6732 |
| 118 | Ga0123354_10033520 | 3300010882 | Bacteria | 8039 |
| 119 | Ga0466733_003819 | 3300042659 | Bacteria | 23682 |
| 120 | Ga0466733_176904 | 3300042659 | Bacteria | 3219 |
| 121 | Ga0466657_191967 | 3300042582 | Bacteria | 1611 |
| 122 | Ga0466691_018781 | 3300042593 | Bacteria | 22071 |
| 123 | Ga0466694_199011 | 3300042594 | Bacteria | 2875 |
| 124 | Ga0466714_021817 | 3300042603 | Bacteria | 7986 |
| 125 | Ga0466714_057218 | 3300042603 | Bacteria | 1616 |
| 126 | Ga0466714_093855 | 3300042603 | Bacteria | 1889 |
| 127 | Ga0466703_179134 | 3300042636 | Bacteria | 10416 |
| 128 | 2227591268 | 2225789004 | Bacteria | 50477 |
| 129 | JGI24702J35022_10000164 | 3300002462 | Bacteria | 34496 |
| 130 | JGI24705J35276_12222384 | 3300002504 | Bacteria | 2417 |
| 131 | Ga0466710_029427 | 3300042613 | Bacteria | 4120 |
| 132 | Ga0466715_426772 | 3300042616 | Bacteria | 11514 |
| 133 | Ga0123356_10104018 | 3300010049 | Bacteria | 2729 |
| 134 | Ga0123353_11049413 | 3300010167 | Bacteria | 1089 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00557 | Peptidase_M24 | Metallopeptidase family M24 | 45 | 247 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.