Protein Family IF03009
Metagenome
Isolate
263
Members
105
Samples
232
Scaffolds
125.75
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10000019|Ga0123353_1000001988
- Length
- 154 aa
- Sequence
- LEKADVRTKARGTEVFVKHKLKTNKRFMARIVGVDLPKNKRGEIGLTYIYGVGRNTAQKILDHAGVSYDTKVQAWNDDQIAAIRGAIADMGIKVEGEARSIVQLNIKRLMDIGCYRGIRHRIGLPVRGQSTKNNARTRKGRKKTVANKKKATK*
Sample Types
Isolate
11.8%
Metagenome
88.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Kalotermitidae
14.1%
Unclassified
10.1%
Culicidae
8.1%
Elmidae
7.1%
Armadillidiidae
6.1%
Argasidae
4.0%
Termopsidae
4.0%
Rhinotermitidae
3.0%
Ixodidae
3.0%
Apidae
2.0%
Hodotermitidae
1.0%
Hydrophilidae
1.0%
Daphniidae
1.0%
Cambaridae
1.0%
Passalidae
1.0%
Taxonomy
Archaea
0
Bacteria
217
Eukaryota
0
Viruses
0
Unclassified
46
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 2 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 3 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 4 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 5 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 6 | 2565956565 | Borrelia coriaceae Co53 | Isolate | Argasidae |
| 7 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 8 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 9 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 10 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 14 | 8114010755 | Borrelia coriaceae Co53 | Isolate | Argasidae |
| 15 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 16 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 17 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 18 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 30 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 31 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 32 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 33 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 34 | 2775507261 | Borrelia turicatae 91E135 | Isolate | Argasidae |
| 35 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 39 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 40 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 41 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 42 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 43 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 44 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 45 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 46 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 47 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 48 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 49 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 50 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 51 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 52 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 53 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 54 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 55 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 56 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 57 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 58 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 59 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 60 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 61 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 62 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 63 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 64 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 65 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 66 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 67 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 68 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 69 | 2820219087 | Unclassified Ignavibacteria Th196P3bin14 | Isolate | Unclassified |
| 70 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 71 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 72 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 73 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 74 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 75 | 2545555866 | Borrelia coriaceae ATCC 43381 | Isolate | Argasidae |
| 76 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 77 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 78 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 79 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 80 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 81 | 2881226535 | Candidatus Borreliella tachyglossi Bc-F10-1268 | Isolate | Ixodidae |
| 82 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 83 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 84 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 85 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 86 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 87 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 88 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 89 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 90 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 91 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 92 | 2848878685 | Borrelia miyamotoi CA17-2241 | Isolate | Ixodidae |
| 93 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 94 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 95 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 96 | 2718218422 | Borrelia miyamotoi CT13-2396 | Isolate | Ixodidae |
| 97 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 98 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 99 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 100 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 101 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 102 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 103 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 104 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 105 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_036550 | 3300042612 | Bacteria | 1769 |
| 2 | Ga0466732_321050 | 3300042656 | Unclassified | 1013 |
| 3 | Ga0466733_000945 | 3300042659 | Bacteria | 2328 |
| 4 | Ga0466723_039697 | 3300042618 | Bacteria | 34610 |
| 5 | Ga0466726_370771 | 3300042619 | Bacteria | 16090 |
| 6 | Ga0123356_10598625 | 3300010049 | Unclassified | 1267 |
| 7 | Ga0123353_10040952 | 3300010167 | Unclassified | 7313 |
| 8 | Ga0123353_10813144 | 3300010167 | Unclassified | 1288 |
| 9 | Ga0123354_10376320 | 3300010882 | Unclassified | 1232 |
| 10 | Ga0123354_10401434 | 3300010882 | Bacteria | 1160 |
| 11 | Ga0160464_101911 | 3300012805 | Bacteria | 5024 |
| 12 | Ga0160453_100102 | 3300012814 | Bacteria | 86683 |
| 13 | Ga0160446_100002 | 3300012835 | Bacteria | 540874 |
| 14 | Ga0265387_1000159 | 3300024582 | Bacteria | 12397 |
| 15 | Ga0415639_089709 | 3300038395 | Unclassified | 1260 |
| 16 | Ga0466690_040168 | 3300042590 | Bacteria | 26767 |
| 17 | Ga0466690_099811 | 3300042590 | Bacteria | 17385 |
| 18 | Ga0466694_222711 | 3300042594 | Unclassified | 1072 |
| 19 | Ga0466699_115841 | 3300042597 | Bacteria | 8554 |
| 20 | Ga0466699_192329 | 3300042597 | Bacteria | 4717 |
| 21 | Ga0466714_119191 | 3300042603 | Bacteria | 1559 |
| 22 | Ga0466714_132072 | 3300042603 | Bacteria | 14433 |
| 23 | Ga0466720_016647 | 3300042607 | Bacteria | 1061 |
| 24 | Ga0466731_283723 | 3300042622 | Bacteria | 5069 |
| 25 | Ga0466734_072658 | 3300042623 | Bacteria | 4707 |
| 26 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 27 | Ga0466703_099949 | 3300042636 | Unclassified | 2057 |
| 28 | Ga0466725_002696 | 3300042654 | Unclassified | 1386 |
| 29 | JGI24702J35022_10390977 | 3300002462 | Bacteria | 838 |
| 30 | Meta3P_1019975 | 3300002464 | Unclassified | 788 |
| 31 | Ga0466733_010991 | 3300042659 | Bacteria | 23768 |
| 32 | Ga0466733_031543 | 3300042659 | Bacteria | 31583 |
| 33 | Ga0466733_120852 | 3300042659 | Bacteria | 8712 |
| 34 | Ga0466733_127261 | 3300042659 | Bacteria | 9314 |
| 35 | Ga0466733_192215 | 3300042659 | Bacteria | 3279 |
| 36 | Ga0466728_387292 | 3300042620 | Bacteria | 5140 |
| 37 | Ga0466729_005393 | 3300042621 | Bacteria | 4646 |
| 38 | Ga0123357_10665192 | 3300009784 | Bacteria | 763 |
| 39 | Ga0123356_10089812 | 3300010049 | Bacteria | 2924 |
| 40 | Ga0123353_10787402 | 3300010167 | Unclassified | 1316 |
| 41 | Ga0160456_100021 | 3300012820 | Bacteria | 275495 |
| 42 | Ga0160459_114814 | 3300012831 | Bacteria | 887 |
| 43 | Ga0160445_101709 | 3300012847 | Bacteria | 5812 |
| 44 | Ga0160457_1016083 | 3300012858 | Unclassified | 1050 |
| 45 | Ga0265387_1000894 | 3300024582 | Bacteria | 4515 |
| 46 | Ga0466690_007417 | 3300042590 | Bacteria | 13185 |
| 47 | Ga0466690_066638 | 3300042590 | Bacteria | 4998 |
| 48 | Ga0466692_123493 | 3300042591 | Bacteria | 3624 |
| 49 | Ga0466695_228876 | 3300042595 | Bacteria | 8580 |
| 50 | Ga0466699_427773 | 3300042597 | Bacteria | 1200 |
| 51 | Ga0466701_044912 | 3300042598 | Bacteria | 3400 |
| 52 | Ga0466706_067758 | 3300042599 | Bacteria | 37640 |
| 53 | Ga0466707_326330 | 3300042601 | Bacteria | 275336 |
| 54 | Ga0466714_117089 | 3300042603 | Bacteria | 1404 |
| 55 | Ga0466714_121852 | 3300042603 | Unclassified | 1512 |
| 56 | Ga0466714_122728 | 3300042603 | Bacteria | 1166 |
| 57 | Ga0466714_131317 | 3300042603 | Bacteria | 1150 |
| 58 | Ga0466698_068647 | 3300042610 | Bacteria | 2761 |
| 59 | Ga0466731_382255 | 3300042622 | Unclassified | 1265 |
| 60 | Ga0466735_065716 | 3300042624 | Unclassified | 1417 |
| 61 | Ga0466735_114961 | 3300042624 | Bacteria | 12299 |
| 62 | IMNBL1DRAFT_c0002479 | 3300000062 | Bacteria | 12828 |
| 63 | JGI24699J35502_10699741 | 3300002509 | Unclassified | 765 |
| 64 | JGI24696J40584_12936145 | 3300002834 | Unclassified | 1574 |
| 65 | Ga0466710_025485 | 3300042613 | Bacteria | 2500 |
| 66 | Ga0466710_084506 | 3300042613 | Bacteria | 1846 |
| 67 | Ga0466711_141717 | 3300042615 | Bacteria | 15726 |
| 68 | Ga0466715_233748 | 3300042616 | Bacteria | 12000 |
| 69 | Ga0466723_361769 | 3300042618 | Bacteria | 7347 |
| 70 | Ga0123353_10000019 | 3300010167 | Bacteria | 185006 |
| 71 | Ga0123353_10319797 | 3300010167 | Bacteria | 2356 |
| 72 | Ga0160431_113799 | 3300012828 | Bacteria | 919 |
| 73 | Ga0160443_108986 | 3300012848 | Unclassified | 1186 |
| 74 | Ga0265387_1003786 | 3300024582 | Bacteria | 2077 |
| 75 | Ga0415639_255505 | 3300038395 | Unclassified | 950 |
| 76 | Ga0466696_292634 | 3300042596 | Bacteria | 17358 |
| 77 | Ga0466706_013322 | 3300042599 | Bacteria | 22899 |
| 78 | Ga0466706_186042 | 3300042599 | Bacteria | 6626 |
| 79 | Ga0466706_242827 | 3300042599 | Unclassified | 1077 |
| 80 | Ga0466707_176542 | 3300042601 | Bacteria | 1106 |
| 81 | Ga0466714_008241 | 3300042603 | Bacteria | 9647 |
| 82 | Ga0466714_046055 | 3300042603 | Bacteria | 3018 |
| 83 | Ga0466714_053981 | 3300042603 | Bacteria | 7171 |
| 84 | Ga0466714_165554 | 3300042603 | Bacteria | 1440 |
| 85 | Ga0466731_118000 | 3300042622 | Bacteria | 1210 |
| 86 | Ga0466734_101611 | 3300042623 | Bacteria | 2843 |
| 87 | Ga0466704_256111 | 3300042643 | Bacteria | 159283 |
| 88 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 89 | IMNBL1DRAFT_c0005530 | 3300000062 | Bacteria | 7194 |
| 90 | IMNBL1DRAFT_c0013643 | 3300000062 | Bacteria | 3631 |
| 91 | JGI24702J35022_10012616 | 3300002462 | Bacteria | 4692 |
| 92 | JGI24702J35022_10769999 | 3300002462 | Unclassified | 599 |
| 93 | JGI24705J35276_12238295 | 3300002504 | Bacteria | 18753 |
| 94 | Ga0072940_1088204 | 3300005200 | Bacteria | 5267 |
| 95 | Ga0466697_154536 | 3300042611 | Bacteria | 6155 |
| 96 | Ga0466705_336554 | 3300042612 | Bacteria | 16075 |
| 97 | Ga0466733_090216 | 3300042659 | Bacteria | 6126 |
| 98 | Ga0466710_140308 | 3300042613 | Bacteria | 2219 |
| 99 | Ga0466718_052650 | 3300042617 | Bacteria | 1690 |
| 100 | Ga0466726_322340 | 3300042619 | Bacteria | 4421 |
| 101 | Ga0466729_049958 | 3300042621 | Bacteria | 3320 |
| 102 | Ga0123357_10195255 | 3300009784 | Bacteria | 2320 |
| 103 | Ga0123357_10451178 | 3300009784 | Bacteria | 1115 |
| 104 | Ga0123356_10409024 | 3300010049 | Unclassified | 1496 |
| 105 | Ga0123353_10674333 | 3300010167 | Bacteria | 1457 |
| 106 | Ga0160472_100687 | 3300012839 | Bacteria | 16430 |
| 107 | Ga0265387_1049511 | 3300024582 | Bacteria | 750 |
| 108 | Ga0466690_299055 | 3300042590 | Bacteria | 5824 |
| 109 | Ga0466695_392766 | 3300042595 | Bacteria | 1006 |
| 110 | Ga0466696_396970 | 3300042596 | Bacteria | 18436 |
| 111 | Ga0466699_315323 | 3300042597 | Bacteria | 1916 |
| 112 | Ga0466700_267380 | 3300042600 | Bacteria | 1344 |
| 113 | Ga0466714_052693 | 3300042603 | Unclassified | 1261 |
| 114 | Ga0466714_063295 | 3300042603 | Bacteria | 11290 |
| 115 | Ga0466722_035372 | 3300042609 | Bacteria | 7656 |
| 116 | Ga0466704_200902 | 3300042643 | Bacteria | 34955 |
| 117 | Ga0466709_379753 | 3300042648 | Bacteria | 47793 |
| 118 | Ga0466708_151421 | 3300042652 | Bacteria | 8733 |
| 119 | HBC_ctgsDRAFT_1000005 | 3300000333 | Bacteria | 62596 |
| 120 | JGI24702J35022_10216510 | 3300002462 | Bacteria | 1102 |
| 121 | Ga0072940_1459873 | 3300005200 | Unclassified | 588 |
| 122 | Ga0466697_098808 | 3300042611 | Bacteria | 2604 |
| 123 | Ga0466732_172340 | 3300042656 | Bacteria | 1192 |
| 124 | Ga0466733_103003 | 3300042659 | Bacteria | 1630 |
| 125 | Ga0466733_158679 | 3300042659 | Bacteria | 2988 |
| 126 | Ga0466710_393484 | 3300042613 | Bacteria | 1138 |
| 127 | Ga0466712_105574 | 3300042614 | Bacteria | 1146 |
| 128 | Ga0466723_299798 | 3300042618 | Bacteria | 46375 |
| 129 | Ga0123356_10042047 | 3300010049 | Bacteria | 4258 |
| 130 | Ga0123356_10100197 | 3300010049 | Bacteria | 2778 |
| 131 | Ga0123353_10400243 | 3300010167 | Unclassified | 2044 |
| 132 | Ga0123353_10594080 | 3300010167 | Unclassified | 1584 |
| 133 | Ga0160465_100010 | 3300012803 | Bacteria | 359268 |
| 134 | Ga0265387_1071130 | 3300024582 | Bacteria | 671 |
| 135 | Ga0466656_203661 | 3300042550 | Bacteria | 1099 |
| 136 | Ga0466657_104593 | 3300042582 | Bacteria | 11833 |
| 137 | Ga0466694_253804 | 3300042594 | Bacteria | 3371 |
| 138 | Ga0466695_042454 | 3300042595 | Bacteria | 1593 |
| 139 | Ga0466696_412028 | 3300042596 | Bacteria | 31787 |
| 140 | Ga0466699_243584 | 3300042597 | Bacteria | 1333 |
| 141 | Ga0466701_070559 | 3300042598 | Bacteria | 2112 |
| 142 | Ga0466714_094171 | 3300042603 | Bacteria | 3500 |
| 143 | Ga0466714_131680 | 3300042603 | Unclassified | 1970 |
| 144 | Ga0466714_149293 | 3300042603 | Bacteria | 1780 |
| 145 | Ga0466720_150094 | 3300042607 | Bacteria | 1214 |
| 146 | Ga0466729_204724 | 3300042621 | Bacteria | 3811 |
| 147 | Ga0466708_137425 | 3300042652 | Bacteria | 6732 |
| 148 | IMNBL1DRAFT_c0024837 | 3300000062 | Bacteria | 2311 |
| 149 | JGI24705J35276_12176267 | 3300002504 | Bacteria | 1330 |
| 150 | Ga0068302_10032437 | 3300005071 | Bacteria | 1009 |
| 151 | Ga0466732_324498 | 3300042656 | Bacteria | 5229 |
| 152 | Ga0466710_393413 | 3300042613 | Bacteria | 1165 |
| 153 | Ga0466723_146229 | 3300042618 | Bacteria | 13585 |
| 154 | Ga0466728_027008 | 3300042620 | Bacteria | 23890 |
| 155 | Ga0123356_10200540 | 3300010049 | Bacteria | 2034 |
| 156 | Ga0123353_10328761 | 3300010167 | Bacteria | 2315 |
| 157 | Ga0123353_10913739 | 3300010167 | Bacteria | 1193 |
| 158 | Ga0123353_11686292 | 3300010167 | Unclassified | 795 |
| 159 | Ga0160469_100154 | 3300012824 | Bacteria | 76254 |
| 160 | Ga0160431_102943 | 3300012828 | Bacteria | 3724 |
| 161 | Ga0265387_1019052 | 3300024582 | Bacteria | 1010 |
| 162 | Ga0265387_1035081 | 3300024582 | Bacteria | 833 |
| 163 | Ga0466656_144693 | 3300042550 | Unclassified | 1180 |
| 164 | Ga0466657_056447 | 3300042582 | Bacteria | 5880 |
| 165 | Ga0466692_120097 | 3300042591 | Bacteria | 76506 |
| 166 | Ga0466694_270523 | 3300042594 | Bacteria | 3744 |
| 167 | Ga0466701_006599 | 3300042598 | Unclassified | 1096 |
| 168 | Ga0466700_244408 | 3300042600 | Bacteria | 3137 |
| 169 | Ga0466714_038037 | 3300042603 | Bacteria | 1564 |
| 170 | Ga0466714_082785 | 3300042603 | Bacteria | 1695 |
| 171 | Ga0466719_489579 | 3300042606 | Bacteria | 3276 |
| 172 | Ga0466719_525087 | 3300042606 | Bacteria | 2400 |
| 173 | Ga0466708_134998 | 3300042652 | Bacteria | 4614 |
| 174 | Ga0466727_063087 | 3300042655 | Bacteria | 8570 |
| 175 | IMNBL1DRAFT_c0136355 | 3300000062 | Bacteria | 636 |
| 176 | JGI24695J34938_10088980 | 3300002450 | Unclassified | 1268 |
| 177 | Ga0466733_118364 | 3300042659 | Unclassified | 1773 |
| 178 | Ga0466733_201866 | 3300042659 | Unclassified | 1998 |
| 179 | Ga0466712_171430 | 3300042614 | Bacteria | 4180 |
| 180 | Ga0466715_447718 | 3300042616 | Bacteria | 22881 |
| 181 | Ga0466715_526482 | 3300042616 | Bacteria | 17665 |
| 182 | Ga0466726_230276 | 3300042619 | Bacteria | 6277 |
| 183 | Ga0466728_035321 | 3300042620 | Bacteria | 8591 |
| 184 | Ga0123356_10900684 | 3300010049 | Unclassified | 1056 |
| 185 | Ga0123353_10003138 | 3300010167 | Bacteria | 20743 |
| 186 | Ga0123353_10073668 | 3300010167 | Bacteria | 5489 |
| 187 | Ga0123353_12626660 | 3300010167 | Bacteria | 595 |
| 188 | Ga0160469_105177 | 3300012824 | Bacteria | 1399 |
| 189 | Ga0160452_101706 | 3300012834 | Bacteria | 5807 |
| 190 | Ga0466656_262105 | 3300042550 | Unclassified | 1142 |
| 191 | Ga0466691_037573 | 3300042593 | Bacteria | 71526 |
| 192 | Ga0466691_120386 | 3300042593 | Unclassified | 1826 |
| 193 | Ga0466694_367513 | 3300042594 | Bacteria | 4475 |
| 194 | Ga0466701_103321 | 3300042598 | Bacteria | 3595 |
| 195 | Ga0466706_010117 | 3300042599 | Bacteria | 3696 |
| 196 | Ga0466706_103986 | 3300042599 | Bacteria | 16586 |
| 197 | Ga0466700_070972 | 3300042600 | Bacteria | 5428 |
| 198 | Ga0466714_039724 | 3300042603 | Unclassified | 1128 |
| 199 | Ga0466716_046815 | 3300042605 | Bacteria | 19887 |
| 200 | Ga0466719_191078 | 3300042606 | Bacteria | 1886 |
| 201 | Ga0466698_042864 | 3300042610 | Unclassified | 2937 |
| 202 | Ga0466734_103769 | 3300042623 | Bacteria | 2439 |
| 203 | Ga0466735_092339 | 3300042624 | Bacteria | 1736 |
| 204 | Ga0466703_234792 | 3300042636 | Bacteria | 10454 |
| 205 | Ga0466725_071536 | 3300042654 | Unclassified | 1062 |
| 206 | JGI24702J35022_10000837 | 3300002462 | Bacteria | 19047 |
| 207 | JGI24696J40584_12934250 | 3300002834 | Unclassified | 1536 |
| 208 | JGI24696J40584_12943169 | 3300002834 | Bacteria | 1765 |
| 209 | Ga0466697_118727 | 3300042611 | Unclassified | 1427 |
| 210 | Ga0466733_003819 | 3300042659 | Bacteria | 23682 |
| 211 | Ga0466733_176904 | 3300042659 | Bacteria | 3219 |
| 212 | Ga0466710_356693 | 3300042613 | Bacteria | 1271 |
| 213 | Ga0466715_264678 | 3300042616 | Bacteria | 6380 |
| 214 | Ga0123356_11709538 | 3300010049 | Bacteria | 781 |
| 215 | Ga0123353_10000175 | 3300010167 | Bacteria | 81609 |
| 216 | Ga0123354_10128845 | 3300010882 | Bacteria | 3211 |
| 217 | Ga0160472_100005 | 3300012839 | Bacteria | 734812 |
| 218 | Ga0160433_100091 | 3300012846 | Bacteria | 91670 |
| 219 | Ga0160445_138889 | 3300012847 | Unclassified | 553 |
| 220 | Ga0265387_1115583 | 3300024582 | Unclassified | 574 |
| 221 | Ga0466656_008977 | 3300042550 | Unclassified | 1019 |
| 222 | Ga0466700_371281 | 3300042600 | Unclassified | 1397 |
| 223 | Ga0466714_021817 | 3300042603 | Bacteria | 7986 |
| 224 | Ga0466714_093855 | 3300042603 | Bacteria | 1889 |
| 225 | Ga0466714_154795 | 3300042603 | Unclassified | 2509 |
| 226 | Ga0466729_255369 | 3300042621 | Bacteria | 2791 |
| 227 | Ga0466703_179134 | 3300042636 | Bacteria | 10416 |
| 228 | Ga0466704_373048 | 3300042643 | Bacteria | 2263 |
| 229 | Ga0466709_333044 | 3300042648 | Bacteria | 2060 |
| 230 | Ga0466708_295458 | 3300042652 | Bacteria | 8896 |
| 231 | Ga0466725_380104 | 3300042654 | Bacteria | 28941 |
| 232 | JGI24698J34947_10003141 | 3300002449 | Bacteria | 8946 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00416 | Ribosomal_S13 | Ribosomal protein S13/S18 | 30 | 137 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.