Protein Family IF02999

Metagenome Metatranscriptome Isolate
393 Members
314 Samples
156 Scaffolds
61.24 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_13129336|Ga0123356_131293362
Length
73 aa
Sequence
LDYLLESREEIMAKKSKIESWKKGSKFKARNYSRCERCGRPHGVLKKFGLCRICFRELAYKGQIPGVKKSSW*

πŸ“Š Sample Types

Isolate 60.3%
Metagenome 38.4%
MAG 0.0%
Metatranscriptome 1.3%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 30.4%
Termitidae 14.3%
Apidae 12.6%
Blattidae 8.5%
Scarabaeidae 4.1%
Drosophilidae 3.1%
Halictidae 3.1%
Tenebrionidae 2.7%
Elmidae 2.4%
Culicidae 2.4%
Kalotermitidae 1.7%
Pyralidae 1.7%
Formicidae 1.4%
Rhinotermitidae 1.0%
Bombycidae 1.0%
Noctuidae 1.0%
Termopsidae 1.0%
Hydrophilidae 0.7%
Passalidae 0.7%
Calliphoridae 0.3%
Vespidae 0.3%
Hodotermitidae 0.3%
Dytiscidae 0.3%
Ocypodidae 0.3%
Gomphidae 0.3%
Nephropidae 0.3%
Pentatomidae 0.3%
Portunidae 0.3%
Penaeidae 0.3%
Siricidae 0.3%
Euphausiidae 0.3%
Acrididae 0.3%
Curculionidae 0.3%
Libellulidae 0.3%
Eresidae 0.3%
Cerambycidae 0.3%
Armadillidiidae 0.3%

🌳 Taxonomy

Archaea 0
Bacteria 355
Eukaryota 0
Viruses 0
Unclassified 38

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
2 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
3 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
4 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
5 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
6 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
7 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
8 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
9 2900354037 Nocardia macrotermitis RB20 Isolate Termitidae
10 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
11 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
12 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
13 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
14 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
15 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
16 2963634138 Unclassified Bacilli bacterium PM5-3 Isolate Blattidae
17 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
18 2504756063 Isoptericola variabilis J5 Isolate Unclassified
19 2595698193 Melissococcus plutonius B5 Isolate Apidae
20 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
21 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
22 2734481968 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
23 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
24 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
25 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
26 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
27 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
28 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
33 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
34 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
35 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
36 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
37 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
38 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
39 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
40 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
41 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
42 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
43 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
44 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
45 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
46 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
47 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
48 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
49 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
50 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
51 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
52 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
53 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
54 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
55 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
56 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
57 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
58 2505679068 Isoptericola variabilis 225 Isolate Unclassified
59 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
60 2595698195 Melissococcus plutonius 119 Isolate Apidae
61 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
62 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
63 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
64 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
65 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
66 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
67 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
68 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
69 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
70 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
71 2978778678 Bacillus cereus 25 Isolate Ocypodidae
72 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
73 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
74 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
75 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
76 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
77 3300021227 Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA Metatranscriptome Termitidae
78 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
79 8007223943 Enterococcus sp. MSG2901 Isolate
80 8012112996 Staphylococcus muscae ATCC 49910 Isolate
81 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
82 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
83 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
84 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
85 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
86 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
87 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
88 8114555646 Enterococcus sp. DIV1094 Isolate
89 8118997823 Spiroplasma platyhelix PALS-1 Isolate Unclassified
90 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
91 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
92 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
93 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
94 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
95 2900368070 Nocardia aurantia RB56 Isolate Termitidae
96 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
97 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
98 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
99 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
100 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
101 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
102 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
103 2627853628 Melissococcus plutonius 82 Isolate Apidae
104 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
105 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
106 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
107 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
108 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
109 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
110 2969145278 Bacillus cereus 29 Isolate Portunidae
111 3006461590 Streptomyces sp. RB5 Isolate Termitidae
112 3006667155 Streptomyces sp. SID9727 Isolate
113 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
114 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
115 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
116 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
117 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
118 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
119 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
120 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
121 8064008355 Heyndrickxia oleronia Isolate Unclassified
122 8082023105 Niallia sp. Man26 Isolate Penaeidae
123 8112490586 Staphylococcus muscae CCM 4175 Isolate
124 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
125 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
126 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
127 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
128 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
129 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
130 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
131 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
132 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
133 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
134 2537562000 Bacillus cereus HD73 Isolate Pyralidae
135 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
136 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
137 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
138 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
139 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
140 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
141 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
142 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
143 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
144 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
145 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
146 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
147 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
148 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
149 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
150 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
151 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
152 8108568626 Enterococcus sp. DIV1094 Isolate
153 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
154 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
155 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
156 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
157 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
158 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
159 2864909992 Bacillus velezensis S00166 Isolate Elmidae
160 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
161 2896955351 Streptomyces sp. GF20 Isolate Termitidae
162 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
163 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
164 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
165 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
166 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
167 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
168 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
169 2595698199 Melissococcus plutonius 60 Isolate Apidae
170 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
171 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
172 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
173 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
174 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
175 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
176 2820714932 Unclassified Fibrobacteres Nc150P4bin10 Isolate Unclassified
177 2035265001 Acrididae gut microbial communities from Texas A and M University, USA - Sample 321 Metagenome Acrididae
178 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
179 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
180 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
181 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
182 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
183 3300005319 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut Metagenome Drosophilidae
184 3300021217 Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA Metatranscriptome Termitidae
185 3004719924 Lactobacillus sp. W8174 Isolate Apidae
186 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
187 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
188 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
189 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
190 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
191 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
192 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
193 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
194 8007237282 Enterococcus sp. DIV0212c Isolate
195 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
196 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
197 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
198 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
199 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
200 8066802609 Apilactobacillus timberlakei HV_09 Isolate Halictidae
201 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
202 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
203 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
204 2862784999 Streptomyces sp. M41 Isolate Unclassified
205 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
206 2864895409 Bacillus aerius S00152 Isolate Elmidae
207 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
208 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
209 2916858470 Heyndrickxia oleronia Isolate Unclassified
210 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
211 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
212 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
213 2963635624 Unclassified Bacilli bacterium PM5-9 Isolate Blattidae
214 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
215 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
216 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
217 2595698197 Melissococcus plutonius H6 Isolate Apidae
218 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
219 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
220 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
221 2820215626 Unclassified Kiritimatiellaeota Nt197P3bin123 Isolate Unclassified
222 2820217359 Unclassified Kiritimatiellaeota Nt197P3bin101 Isolate Unclassified
223 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
224 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
225 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
226 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
227 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
228 2989426036 Spiroplasma platyhelix PALS-1 Isolate Unclassified
229 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
230 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
231 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
232 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
233 3300005317 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut Metagenome Drosophilidae
234 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
235 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
236 3300007088 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 4 gut Metagenome Drosophilidae
237 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
238 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
239 8022725327 Bacillus sp. SN10 Isolate Eresidae
240 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
241 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
242 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
243 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
244 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
245 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
246 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
247 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
248 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
249 2908241010 Streptomyces sp. HF10 Isolate Termitidae
250 2912817845 Streptomyces griseus SID164 Isolate
251 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
252 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
253 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
254 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
255 2595698198 Melissococcus plutonius L9 Isolate Apidae
256 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
257 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
258 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
259 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
260 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
261 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
262 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
263 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
264 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
265 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
266 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
267 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
268 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
269 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
270 3006468911 Streptomyces sp. RB17 Isolate Termitidae
271 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
272 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
273 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
274 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
275 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
276 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
277 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
278 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
279 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
280 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
281 2864801025 Bacillus aerius S00042 Isolate Elmidae
282 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
283 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
284 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
285 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
286 2547132081 Streptomyces sp. S4 Isolate Formicidae
287 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
288 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
289 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
290 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
291 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
292 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
293 2778260939 Unclassified Fibrobacteres Co191P4bin13 Isolate Unclassified
294 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
295 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
296 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
297 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
298 2820729191 Unclassified Chloroflexi Th196P4bin49 Isolate Unclassified
299 2820471304 Unclassified Firmicutes Lab288P1bin89 Isolate Unclassified
300 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
301 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
302 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
303 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
304 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
305 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
306 3300023282 Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA Metatranscriptome Termitidae
307 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
308 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
309 3300060775 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
310 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
311 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
312 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
313 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
314 8077780672 Enterococcus sp. PLM3 Isolate Formicidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_127839 3300042656 Bacteria 4125
2 Ga0530661_164822 3300056564 Bacteria 579
3 Ga0466693_213355 3300042592 Unclassified 1432
4 Ga0466691_105136 3300042593 Bacteria 11830
5 Ga0466694_073322 3300042594 Unclassified 4664
6 Ga0466707_273021 3300042601 Bacteria 1834
7 Ga0466721_203951 3300042608 Bacteria 12739
8 Ga0123353_10638132 3300010167 Unclassified 1511
9 Ga0466731_335232 3300042622 Unclassified 2726
10 Ga0466702_228499 3300042635 Unclassified 4022
11 Ga0466710_042397 3300042613 Unclassified 1355
12 Ga0466710_372862 3300042613 Bacteria 1592
13 Ga0466718_016351 3300042617 Bacteria 1635
14 AustNasuHG_c1003476 3300000089 Unclassified 5688
15 AustNasuHG_c1020243 3300000089 Bacteria 2170
16 JGI24699J35502_10268183 3300002509 Bacteria 507
17 Ga0562375_0511 3300056856 Bacteria 79486
18 Ga0562376_2522 3300056857 Bacteria 21571
19 Ga0160458_111123 3300012832 Unclassified 999
20 Ga0160452_100013 3300012834 Bacteria 343612
21 Ga0160447_119197 3300012849 Bacteria 1140
22 Ga0466706_026885 3300042599 Bacteria 6178
23 Ga0466706_174853 3300042599 Bacteria 1896
24 Ga0466707_031260 3300042601 Bacteria 71521
25 Ga0123356_10075827 3300010049 Bacteria 3168
26 Ga0123353_10061824 3300010167 Bacteria 6007
27 Ga0123353_10696053 3300010167 Bacteria 1428
28 Ga0123354_10934409 3300010882 Bacteria 565
29 Ga0466734_061199 3300042623 Unclassified 1783
30 Ga0466735_023118 3300042624 Bacteria 12000
31 2227264135 2225789004 Bacteria 6971
32 AustNasuHG_c1068534 3300000089 Unclassified 649
33 JGI24700J35501_10649385 3300002508 Unclassified 1033
34 JGI24700J35501_10930786 3300002508 Bacteria 23988
35 Ga0074304_1168467 3300005319 Bacteria 693
36 Ga0074278_145589 3300005721 Bacteria 4691
37 Ga0466733_006507 3300042659 Bacteria 7219
38 Ga0530661_000008 3300056564 Bacteria 327436
39 Ga0562379_1450 3300056790 Unclassified 26930
40 Ga0562378_0002 3300056814 Bacteria 3519472
41 Ga0562376_0011 3300056857 Bacteria 876793
42 Ga0415639_068661 3300038395 Unclassified 3636
43 Ga0466706_140589 3300042599 Bacteria 4364
44 Ga0466707_302603 3300042601 Bacteria 62986
45 Ga0466713_080378 3300042602 Bacteria 107053
46 Ga0123355_10290095 3300009826 Bacteria 2246
47 Ga0123356_10000101 3300010049 Bacteria 90121
48 Ga0123356_10015115 3300010049 Bacteria 7402
49 Ga0123356_10133250 3300010049 Bacteria 2438
50 Ga0123356_10936628 3300010049 Unclassified 1037
51 Ga0466730_055372 3300042625 Unclassified 1236
52 Ga0466725_321089 3300042654 Bacteria 1954
53 Ga0466712_105311 3300042614 Bacteria 19617
54 GhopperDRAF_NODE_227854_len_5198_cov_6_873797 2035265001 Unclassified 5228
55 JGI24702J35022_10269540 3300002462 Bacteria 996
56 JGI24699J35502_11084317 3300002509 Bacteria 2024
57 Ga0052191_103085 3300003097 Unclassified 2862
58 Ga0068305_11030627 3300005083 Bacteria 1285
59 Ga0072940_1043960 3300005200 Bacteria 547
60 Ga0072940_1088023 3300005200 Bacteria 3651
61 Ga0074278_150002 3300005721 Unclassified 1105
62 Ga0104050_1208947 3300007153 Bacteria 1043
63 Ga0104147_1065731 3300007224 Bacteria 6503
64 Ga0223688_1044049 3300021227 Unclassified 1312
65 Ga0466692_180088 3300042591 Bacteria 1525
66 Ga0466693_352601 3300042592 Bacteria 5048
67 Ga0466700_041154 3300042600 Bacteria 59068
68 Ga0123355_11573523 3300009826 Bacteria 635
69 Ga0160466_100074 3300012809 Bacteria 108538
70 Ga0466710_143511 3300042613 Bacteria 1252
71 Ga0466711_427785 3300042615 Bacteria 1564
72 2227464112 2225789004 Bacteria 5265
73 IMNBL1DRAFT_c0000035 3300000062 Bacteria 120274
74 Ga0052191_101302 3300003097 Bacteria 4511
75 Ga0072940_1177338 3300005200 Unclassified 823
76 Ga0072940_1181246 3300005200 Bacteria 1763
77 Ga0074311_1022812 3300005317 Unclassified 524
78 Ga0466657_181717 3300042582 Bacteria 1620
79 Ga0466694_045907 3300042594 Bacteria 14153
80 Ga0466706_175288 3300042599 Bacteria 3442
81 Ga0466706_193746 3300042599 Unclassified 1984
82 Ga0466707_080865 3300042601 Bacteria 320076
83 Ga0466722_240797 3300042609 Bacteria 12349
84 Ga0123356_10074580 3300010049 Unclassified 3193
85 Ga0123356_10788528 3300010049 Unclassified 1121
86 Ga0123356_10813949 3300010049 Bacteria 1105
87 Ga0123356_11556427 3300010049 Bacteria 817
88 Ga0123356_13129336 3300010049 Bacteria 577
89 Ga0123353_10000786 3300010167 Bacteria 38674
90 Ga0123353_10488355 3300010167 Unclassified 1799
91 Ga0123353_11877871 3300010167 Bacteria 740
92 Ga0466697_203293 3300042611 Bacteria 2666
93 Ga0466724_02361 3300042649 Bacteria 34785
94 Ga0466727_281726 3300042655 Bacteria 41168
95 Ga0466728_452942 3300042620 Bacteria 39308
96 2227334419 2225789004 Bacteria 1167
97 HBC_ctgsDRAFT_1113117 3300000333 Bacteria 620
98 JGI24702J35022_10001355 3300002462 Bacteria 15206
99 Ga0074278_153159 3300005721 Unclassified 8715
100 Ga0104047_1122724 3300007088 Bacteria 1031
101 Ga0466733_189005 3300042659 Bacteria 2529
102 Ga0562378_0039 3300056814 Bacteria 444185
103 Ga0562376_0381 3300056857 Bacteria 84233
104 Ga0160434_100001 3300012850 Bacteria 617314
105 Ga0466657_291877 3300042582 Bacteria 2136
106 Ga0466693_054211 3300042592 Bacteria 1506
107 Ga0466693_110507 3300042592 Bacteria 60686
108 Ga0466693_353530 3300042592 Bacteria 63745
109 Ga0466694_384803 3300042594 Unclassified 3011
110 Ga0466699_092558 3300042597 Bacteria 14678
111 Ga0466707_221470 3300042601 Bacteria 71824
112 Ga0123356_11305313 3300010049 Bacteria 889
113 Ga0160471_109349 3300012812 Unclassified 1106
114 Ga0466697_085137 3300042611 Bacteria 1486
115 Ga0466734_119789 3300042623 Bacteria 17928
116 Ga0466734_165799 3300042623 Bacteria 1539
117 Ga0466730_011725 3300042625 Bacteria 8736
118 Ga0466702_002868 3300042635 Bacteria 60427
119 Ga0466724_29488 3300042649 Bacteria 2715
120 2227579352 2225789004 Bacteria 2526
121 JGI24702J35022_10236341 3300002462 Bacteria 1058
122 JGI24703J35330_11745970 3300002501 Bacteria 4893
123 JGI24696J40584_12960731 3300002834 Bacteria 8246
124 Ga0068302_10003269 3300005071 Bacteria 26234
125 Ga0072941_1015007 3300005201 Bacteria 54434
126 Ga0074278_102385 3300005721 Unclassified 1377
127 Ga0562376_4501 3300056857 Bacteria 11347
128 Ga0590799_10281 3300060775 Bacteria 807
129 Ga0160456_110753 3300012820 Bacteria 942
130 Ga0160435_1005671 3300012857 Bacteria 2807
131 Ga0223687_100094 3300021217 Bacteria 12922
132 Ga0255808_1000340 3300023282 Bacteria 3082
133 Ga0466690_302022 3300042590 Bacteria 1736
134 Ga0123357_10108130 3300009784 Bacteria 3558
135 Ga0123356_11787598 3300010049 Unclassified 764
136 Ga0123354_10263339 3300010882 Bacteria 1716
137 Ga0466730_086863 3300042625 Bacteria 4535
138 2212886490 2209111004 Bacteria 17554
139 2227507956 2225789004 Bacteria 66298
140 AustNasuHG_c1066938 3300000089 Unclassified 665
141 Ga0072940_1342690 3300005200 Unclassified 525
142 Ga0466733_025245 3300042659 Bacteria 172347
143 Ga0160436_1000497 3300012861 Unclassified 14828
144 Ga0255808_1015762 3300023282 Bacteria 3377
145 Ga0466692_176196 3300042591 Unclassified 1169
146 Ga0466696_293106 3300042596 Bacteria 1036
147 Ga0466707_175608 3300042601 Bacteria 13441
148 Ga0466698_337436 3300042610 Bacteria 1590
149 Ga0123356_10051797 3300010049 Bacteria 3819
150 Ga0123356_12924537 3300010049 Unclassified 597
151 Ga0123353_10172445 3300010167 Unclassified 3432
152 Ga0160442_100131 3300012806 Unclassified 75763
153 2227524329 2225789004 Unclassified 653
154 IMNBL1DRAFT_c0000629 3300000062 Bacteria 28167
155 JGI24702J35022_10006179 3300002462 Bacteria 6940
156 JGI24699J35502_11127257 3300002509 Bacteria 4115

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00253 Ribosomal_S14 Ribosomal protein S14p/S29e 21 71 0.94

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.