Protein Family IF02960
Metagenome
Metatranscriptome
Isolate
306
Members
74
Samples
288
Scaffolds
59.55
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_11032371|Ga0123356_110323712
- Length
- 68 aa
- Sequence
- MQASKGYGMKKIILFFKESYAELRKVVWPGRDDVISSVKVVLISTVIIAAVLGLIDFVLLLGVRAIF*
Sample Types
Isolate
5.9%
Metagenome
91.8%
MAG
0.0%
Metatranscriptome
2.3%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.9%
Unclassified
27.5%
Kalotermitidae
18.8%
Rhinotermitidae
5.8%
Termopsidae
2.9%
Taxonomy
Archaea
0
Bacteria
275
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 2 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 6 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 7 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 15 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 24 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 25 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 26 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 29 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 30 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 31 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 32 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 33 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 34 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 35 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 36 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 41 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 42 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 43 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 46 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 47 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 48 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 49 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 50 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 51 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 52 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 55 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 56 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 57 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 58 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 59 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 60 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 61 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 62 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 63 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 64 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 65 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 66 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 67 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 68 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 69 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 70 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 71 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 72 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 73 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 74 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_479965 | 3300042612 | Bacteria | 20919 |
| 2 | Ga0466712_065545 | 3300042614 | Bacteria | 16733 |
| 3 | Ga0466712_132883 | 3300042614 | Bacteria | 18326 |
| 4 | Ga0466712_242979 | 3300042614 | Unclassified | 1404 |
| 5 | Ga0466723_276421 | 3300042618 | Bacteria | 25634 |
| 6 | Ga0466726_224141 | 3300042619 | Bacteria | 5509 |
| 7 | Ga0123357_10217591 | 3300009784 | Bacteria | 2128 |
| 8 | Ga0123357_10348540 | 3300009784 | Unclassified | 1420 |
| 9 | Ga0123356_10181692 | 3300010049 | Bacteria | 2126 |
| 10 | Ga0123356_10229441 | 3300010049 | Bacteria | 1920 |
| 11 | Ga0123356_10346783 | 3300010049 | Bacteria | 1607 |
| 12 | Ga0123356_11032371 | 3300010049 | Bacteria | 992 |
| 13 | Ga0123353_11139507 | 3300010167 | Bacteria | 1031 |
| 14 | Ga0123353_11927714 | 3300010167 | Bacteria | 727 |
| 15 | Ga0466729_241279 | 3300042621 | Unclassified | 1055 |
| 16 | Ga0466731_151435 | 3300042622 | Bacteria | 1259 |
| 17 | Ga0466702_178652 | 3300042635 | Bacteria | 1528 |
| 18 | Ga0466702_292803 | 3300042635 | Bacteria | 1182 |
| 19 | Ga0466702_384724 | 3300042635 | Unclassified | 1404 |
| 20 | Ga0466703_156606 | 3300042636 | Bacteria | 7268 |
| 21 | Ga0415639_031191 | 3300038395 | Bacteria | 4496 |
| 22 | Ga0415639_061174 | 3300038395 | Bacteria | 1297 |
| 23 | Ga0466690_291619 | 3300042590 | Bacteria | 1467 |
| 24 | Ga0466694_184431 | 3300042594 | Bacteria | 8202 |
| 25 | Ga0466699_334053 | 3300042597 | Bacteria | 4211 |
| 26 | JGI24698J34947_10000090 | 3300002449 | Bacteria | 30429 |
| 27 | JGI24698J34947_10000266 | 3300002449 | Bacteria | 22368 |
| 28 | JGI24695J34938_10000605 | 3300002450 | Bacteria | 34496 |
| 29 | JGI24695J34938_10003330 | 3300002450 | Bacteria | 11311 |
| 30 | JGI24695J34938_10014173 | 3300002450 | Bacteria | 4148 |
| 31 | JGI24695J34938_10021233 | 3300002450 | Bacteria | 3180 |
| 32 | JGI24695J34938_10392994 | 3300002450 | Bacteria | 617 |
| 33 | JGI24696J40584_12874081 | 3300002834 | Bacteria | 1057 |
| 34 | Ga0466719_001502 | 3300042606 | Bacteria | 2560 |
| 35 | Ga0466719_033462 | 3300042606 | Bacteria | 2558 |
| 36 | Ga0466698_453430 | 3300042610 | Bacteria | 1655 |
| 37 | Ga0466705_206560 | 3300042612 | Bacteria | 5661 |
| 38 | Ga0466712_095528 | 3300042614 | Unclassified | 1792 |
| 39 | Ga0466712_152538 | 3300042614 | Bacteria | 9608 |
| 40 | Ga0466715_239988 | 3300042616 | Bacteria | 5399 |
| 41 | Ga0466718_026294 | 3300042617 | Bacteria | 8251 |
| 42 | Ga0466718_072376 | 3300042617 | Bacteria | 10012 |
| 43 | Ga0466718_081519 | 3300042617 | Bacteria | 1163 |
| 44 | Ga0466718_111702 | 3300042617 | Bacteria | 1061 |
| 45 | Ga0466718_156256 | 3300042617 | Bacteria | 1517 |
| 46 | Ga0466728_374805 | 3300042620 | Bacteria | 2134 |
| 47 | Ga0123355_10040034 | 3300009826 | Bacteria | 7629 |
| 48 | Ga0123356_10137407 | 3300010049 | Bacteria | 2405 |
| 49 | Ga0123353_10040231 | 3300010167 | Bacteria | 7374 |
| 50 | Ga0466731_208960 | 3300042622 | Bacteria | 1066 |
| 51 | Ga0466731_369471 | 3300042622 | Unclassified | 1433 |
| 52 | Ga0466731_384496 | 3300042622 | Bacteria | 13305 |
| 53 | Ga0466702_294467 | 3300042635 | Bacteria | 1940 |
| 54 | Ga0466702_317587 | 3300042635 | Bacteria | 2174 |
| 55 | Ga0466703_096549 | 3300042636 | Bacteria | 16006 |
| 56 | Ga0466708_164750 | 3300042652 | Bacteria | 41705 |
| 57 | Ga0223674_1001046 | 3300021235 | Bacteria | 565 |
| 58 | Ga0466691_062260 | 3300042593 | Bacteria | 13313 |
| 59 | JGI24698J34947_10013178 | 3300002449 | Bacteria | 4518 |
| 60 | JGI24698J34947_10028484 | 3300002449 | Bacteria | 2956 |
| 61 | JGI24698J34947_10081187 | 3300002449 | Unclassified | 1521 |
| 62 | JGI24698J34947_10082154 | 3300002449 | Unclassified | 1507 |
| 63 | JGI24698J34947_10101848 | 3300002449 | Bacteria | 1289 |
| 64 | JGI24695J34938_10002092 | 3300002450 | Bacteria | 15650 |
| 65 | JGI24695J34938_10006405 | 3300002450 | Bacteria | 7080 |
| 66 | JGI24695J34938_10164708 | 3300002450 | Unclassified | 912 |
| 67 | JGI24695J34938_10554449 | 3300002450 | Bacteria | 531 |
| 68 | JGI24695J34938_10620584 | 3300002450 | Unclassified | 505 |
| 69 | Ga0072941_1135161 | 3300005201 | Unclassified | 1129 |
| 70 | Ga0466700_078152 | 3300042600 | Bacteria | 1443 |
| 71 | Ga0466722_007214 | 3300042609 | Bacteria | 6600 |
| 72 | Ga0466712_069791 | 3300042614 | Bacteria | 11568 |
| 73 | Ga0466712_084897 | 3300042614 | Bacteria | 5641 |
| 74 | Ga0466711_282118 | 3300042615 | Bacteria | 12293 |
| 75 | Ga0466718_120431 | 3300042617 | Bacteria | 4934 |
| 76 | Ga0466718_135236 | 3300042617 | Bacteria | 5160 |
| 77 | Ga0466723_005924 | 3300042618 | Bacteria | 37995 |
| 78 | Ga0466723_356617 | 3300042618 | Bacteria | 4224 |
| 79 | Ga0466726_243384 | 3300042619 | Bacteria | 5255 |
| 80 | Ga0123357_10414330 | 3300009784 | Bacteria | 1210 |
| 81 | Ga0123356_13601342 | 3300010049 | Bacteria | 536 |
| 82 | Ga0123353_10207036 | 3300010167 | Bacteria | 3080 |
| 83 | Ga0123353_10404722 | 3300010167 | Bacteria | 2029 |
| 84 | Ga0123353_11324364 | 3300010167 | Bacteria | 933 |
| 85 | Ga0123353_13237384 | 3300010167 | Bacteria | 521 |
| 86 | Ga0466702_330071 | 3300042635 | Bacteria | 1111 |
| 87 | Ga0466703_302657 | 3300042636 | Bacteria | 56159 |
| 88 | Ga0466703_319445 | 3300042636 | Bacteria | 75536 |
| 89 | Ga0466709_092008 | 3300042648 | Bacteria | 19165 |
| 90 | Ga0264413_102638 | 3300024493 | Bacteria | 8352 |
| 91 | Ga0415639_006632 | 3300038395 | Bacteria | 1986 |
| 92 | Ga0466694_174349 | 3300042594 | Bacteria | 93398 |
| 93 | Ga0466694_355797 | 3300042594 | Bacteria | 1581 |
| 94 | Ga0466699_384213 | 3300042597 | Bacteria | 1239 |
| 95 | AustNasuHG_c1026943 | 3300000089 | Bacteria | 1774 |
| 96 | FAAS_10258752 | 3300001880 | Bacteria | 548 |
| 97 | JGI24698J34947_10053355 | 3300002449 | Bacteria | 2024 |
| 98 | JGI24698J34947_10225693 | 3300002449 | Unclassified | 715 |
| 99 | JGI24702J35022_10972866 | 3300002462 | Bacteria | 528 |
| 100 | JGI24705J35276_11807320 | 3300002504 | Bacteria | 688 |
| 101 | JGI24705J35276_12191408 | 3300002504 | Bacteria | 1474 |
| 102 | Ga0072940_1041929 | 3300005200 | Bacteria | 572 |
| 103 | Ga0072941_1048688 | 3300005201 | Unclassified | 5658 |
| 104 | Ga0072941_1126510 | 3300005201 | Bacteria | 1005 |
| 105 | Ga0074263_125654 | 3300005485 | Unclassified | 911 |
| 106 | Ga0466719_373228 | 3300042606 | Bacteria | 5014 |
| 107 | Ga0466722_173384 | 3300042609 | Bacteria | 3113 |
| 108 | Ga0466712_052688 | 3300042614 | Bacteria | 9878 |
| 109 | Ga0466712_112673 | 3300042614 | Bacteria | 3242 |
| 110 | Ga0466718_043623 | 3300042617 | Bacteria | 13279 |
| 111 | Ga0466726_003699 | 3300042619 | Bacteria | 1772 |
| 112 | Ga0466726_426373 | 3300042619 | Bacteria | 1184 |
| 113 | Ga0123356_10578644 | 3300010049 | Bacteria | 1286 |
| 114 | Ga0123356_11159543 | 3300010049 | Bacteria | 940 |
| 115 | Ga0123356_11503306 | 3300010049 | Bacteria | 831 |
| 116 | Ga0123356_13294824 | 3300010049 | Bacteria | 561 |
| 117 | Ga0123356_13384592 | 3300010049 | Bacteria | 554 |
| 118 | Ga0123353_10407832 | 3300010167 | Bacteria | 2019 |
| 119 | Ga0123353_11098451 | 3300010167 | Bacteria | 1056 |
| 120 | Ga0123353_11382525 | 3300010167 | Bacteria | 907 |
| 121 | Ga0466729_260069 | 3300042621 | Bacteria | 2395 |
| 122 | Ga0466702_195907 | 3300042635 | Bacteria | 1139 |
| 123 | Ga0466708_373925 | 3300042652 | Bacteria | 4698 |
| 124 | Ga0264413_102639 | 3300024493 | Bacteria | 10745 |
| 125 | Ga0466690_321476 | 3300042590 | Bacteria | 2275 |
| 126 | Ga0466690_395123 | 3300042590 | Bacteria | 1919 |
| 127 | Ga0466693_141209 | 3300042592 | Bacteria | 12935 |
| 128 | Ga0466694_336185 | 3300042594 | Bacteria | 1278 |
| 129 | Ga0466695_199027 | 3300042595 | Bacteria | 1256 |
| 130 | Ga0466699_237438 | 3300042597 | Bacteria | 1615 |
| 131 | JGI24698J34947_10249305 | 3300002449 | Bacteria | 664 |
| 132 | JGI24695J34938_10000099 | 3300002450 | Bacteria | 75735 |
| 133 | JGI24695J34938_10000800 | 3300002450 | Bacteria | 29265 |
| 134 | JGI24695J34938_10029566 | 3300002450 | Bacteria | 2562 |
| 135 | JGI24695J34938_10037986 | 3300002450 | Bacteria | 2184 |
| 136 | JGI24695J34938_10051632 | 3300002450 | Bacteria | 1798 |
| 137 | Ga0072940_1060124 | 3300005200 | Bacteria | 1607 |
| 138 | Ga0072941_1015790 | 3300005201 | Bacteria | 10434 |
| 139 | Ga0072941_1032758 | 3300005201 | Bacteria | 9046 |
| 140 | Ga0466700_297221 | 3300042600 | Bacteria | 1452 |
| 141 | Ga0466707_087110 | 3300042601 | Bacteria | 1803 |
| 142 | Ga0466717_036281 | 3300042604 | Bacteria | 2215 |
| 143 | Ga0466717_281807 | 3300042604 | Bacteria | 1580 |
| 144 | Ga0466716_192898 | 3300042605 | Bacteria | 2224 |
| 145 | Ga0466716_539240 | 3300042605 | Bacteria | 2317 |
| 146 | Ga0466719_453647 | 3300042606 | Bacteria | 2611 |
| 147 | Ga0466722_047388 | 3300042609 | Bacteria | 4801 |
| 148 | Ga0466712_031720 | 3300042614 | Bacteria | 10734 |
| 149 | Ga0466712_304754 | 3300042614 | Bacteria | 3004 |
| 150 | Ga0466728_106020 | 3300042620 | Bacteria | 13273 |
| 151 | Ga0123356_10083945 | 3300010049 | Bacteria | 3018 |
| 152 | Ga0123356_10354620 | 3300010049 | Bacteria | 1592 |
| 153 | Ga0123356_11220932 | 3300010049 | Bacteria | 917 |
| 154 | Ga0123356_11608255 | 3300010049 | Unclassified | 804 |
| 155 | Ga0123356_12518461 | 3300010049 | Bacteria | 644 |
| 156 | Ga0123353_10141834 | 3300010167 | Unclassified | 3847 |
| 157 | Ga0123354_10742767 | 3300010882 | Unclassified | 674 |
| 158 | Ga0466731_378909 | 3300042622 | Bacteria | 25095 |
| 159 | Ga0466702_177701 | 3300042635 | Bacteria | 3087 |
| 160 | Ga0466703_299809 | 3300042636 | Bacteria | 8756 |
| 161 | Ga0466709_188271 | 3300042648 | Bacteria | 2595 |
| 162 | Ga0415639_042330 | 3300038395 | Bacteria | 1169 |
| 163 | Ga0456237_0030424 | 3300041968 | Bacteria | 725 |
| 164 | Ga0466694_070967 | 3300042594 | Bacteria | 4455 |
| 165 | Ga0466699_133677 | 3300042597 | Bacteria | 1442 |
| 166 | JGI24698J34947_10031193 | 3300002449 | Bacteria | 2807 |
| 167 | JGI24698J34947_10140636 | 3300002449 | Bacteria | 1017 |
| 168 | JGI24695J34938_10001642 | 3300002450 | Bacteria | 18624 |
| 169 | JGI24695J34938_10002946 | 3300002450 | Bacteria | 12310 |
| 170 | JGI24695J34938_10041095 | 3300002450 | Bacteria | 2078 |
| 171 | JGI24695J34938_10049940 | 3300002450 | Unclassified | 1837 |
| 172 | JGI24695J34938_10057033 | 3300002450 | Bacteria | 1681 |
| 173 | JGI24695J34938_10112928 | 3300002450 | Bacteria | 1106 |
| 174 | JGI24697J35500_10716215 | 3300002507 | Unclassified | 650 |
| 175 | Ga0072941_1001514 | 3300005201 | Bacteria | 4542 |
| 176 | Ga0466707_227054 | 3300042601 | Bacteria | 1091 |
| 177 | Ga0466707_238271 | 3300042601 | Unclassified | 1297 |
| 178 | Ga0466717_030143 | 3300042604 | Bacteria | 1000 |
| 179 | Ga0466717_224778 | 3300042604 | Bacteria | 1377 |
| 180 | Ga0466712_075027 | 3300042614 | Bacteria | 25514 |
| 181 | Ga0466715_015645 | 3300042616 | Bacteria | 22521 |
| 182 | Ga0466715_277432 | 3300042616 | Bacteria | 20810 |
| 183 | Ga0123356_12647296 | 3300010049 | Bacteria | 628 |
| 184 | Ga0123356_12762623 | 3300010049 | Bacteria | 615 |
| 185 | Ga0123356_13008603 | 3300010049 | Bacteria | 588 |
| 186 | Ga0123353_10679580 | 3300010167 | Bacteria | 1450 |
| 187 | Ga0123354_10551603 | 3300010882 | Bacteria | 869 |
| 188 | Ga0466731_059966 | 3300042622 | Bacteria | 1308 |
| 189 | Ga0466731_294930 | 3300042622 | Bacteria | 1190 |
| 190 | Ga0466731_378409 | 3300042622 | Bacteria | 5460 |
| 191 | Ga0466703_025181 | 3300042636 | Bacteria | 7802 |
| 192 | Ga0223677_1029811 | 3300021239 | Unclassified | 666 |
| 193 | Ga0233288_1139306 | 3300022232 | Bacteria | 581 |
| 194 | Ga0466690_173167 | 3300042590 | Bacteria | 14233 |
| 195 | Ga0466692_019273 | 3300042591 | Bacteria | 43255 |
| 196 | Ga0466691_063820 | 3300042593 | Bacteria | 1156 |
| 197 | Ga0466694_212689 | 3300042594 | Bacteria | 44215 |
| 198 | Ga0466699_022690 | 3300042597 | Bacteria | 8057 |
| 199 | Ga0466699_070921 | 3300042597 | Bacteria | 15430 |
| 200 | AustNasuHG_c1033944 | 3300000089 | Bacteria | 1377 |
| 201 | JGI24698J34947_10025529 | 3300002449 | Bacteria | 3144 |
| 202 | JGI24698J34947_10038120 | 3300002449 | Bacteria | 2494 |
| 203 | JGI24698J34947_10054538 | 3300002449 | Unclassified | 1995 |
| 204 | JGI24698J34947_10123870 | 3300002449 | Bacteria | 1117 |
| 205 | JGI24698J34947_10126750 | 3300002449 | Bacteria | 1098 |
| 206 | JGI24698J34947_10219346 | 3300002449 | Bacteria | 731 |
| 207 | JGI24695J34938_10000406 | 3300002450 | Bacteria | 41980 |
| 208 | JGI24695J34938_10001073 | 3300002450 | Bacteria | 24681 |
| 209 | JGI24695J34938_10004999 | 3300002450 | Bacteria | 8445 |
| 210 | JGI24695J34938_10024518 | 3300002450 | Bacteria | 2896 |
| 211 | JGI24695J34938_10098123 | 3300002450 | Bacteria | 1198 |
| 212 | JGI24695J34938_10284709 | 3300002450 | Bacteria | 710 |
| 213 | JGI24705J35276_12000516 | 3300002504 | Bacteria | 848 |
| 214 | Ga0074263_117613 | 3300005485 | Bacteria | 1433 |
| 215 | Ga0466707_103450 | 3300042601 | Bacteria | 2689 |
| 216 | Ga0466712_010395 | 3300042614 | Bacteria | 3559 |
| 217 | Ga0466712_196414 | 3300042614 | Unclassified | 1157 |
| 218 | Ga0466712_200403 | 3300042614 | Bacteria | 1306 |
| 219 | Ga0466712_312050 | 3300042614 | Bacteria | 1155 |
| 220 | Ga0466715_144394 | 3300042616 | Bacteria | 28053 |
| 221 | Ga0123357_10009120 | 3300009784 | Bacteria | 12491 |
| 222 | Ga0123355_12214222 | 3300009826 | Bacteria | 502 |
| 223 | Ga0123356_10000102 | 3300010049 | Bacteria | 90045 |
| 224 | Ga0123356_10000195 | 3300010049 | Bacteria | 69819 |
| 225 | Ga0123356_10045831 | 3300010049 | Bacteria | 4068 |
| 226 | Ga0123353_11032565 | 3300010167 | Bacteria | 1100 |
| 227 | Ga0123353_11488725 | 3300010167 | Bacteria | 863 |
| 228 | Ga0466704_143217 | 3300042643 | Bacteria | 12752 |
| 229 | Ga0466709_018194 | 3300042648 | Bacteria | 16563 |
| 230 | Ga0466709_060483 | 3300042648 | Bacteria | 14406 |
| 231 | Ga0255809_1068648 | 3300022820 | Unclassified | 505 |
| 232 | Ga0415639_047435 | 3300038395 | Bacteria | 1477 |
| 233 | Ga0466690_164024 | 3300042590 | Bacteria | 9904 |
| 234 | JGI24698J34947_10085650 | 3300002449 | Bacteria | 1463 |
| 235 | JGI24695J34938_10001117 | 3300002450 | Bacteria | 24194 |
| 236 | JGI24695J34938_10004096 | 3300002450 | Bacteria | 9722 |
| 237 | JGI24695J34938_10006698 | 3300002450 | Bacteria | 6862 |
| 238 | JGI24695J34938_10015213 | 3300002450 | Bacteria | 3954 |
| 239 | JGI24695J34938_10066064 | 3300002450 | Unclassified | 1525 |
| 240 | JGI24695J34938_10247809 | 3300002450 | Unclassified | 755 |
| 241 | Ga0072941_1009709 | 3300005201 | Bacteria | 5750 |
| 242 | Ga0466719_163146 | 3300042606 | Bacteria | 5228 |
| 243 | Ga0466720_184952 | 3300042607 | Bacteria | 2132 |
| 244 | Ga0466705_407576 | 3300042612 | Bacteria | 5845 |
| 245 | Ga0466712_004974 | 3300042614 | Unclassified | 3021 |
| 246 | Ga0466712_132951 | 3300042614 | Bacteria | 5362 |
| 247 | Ga0466711_390379 | 3300042615 | Bacteria | 8740 |
| 248 | Ga0466718_054210 | 3300042617 | Bacteria | 8618 |
| 249 | Ga0466718_103227 | 3300042617 | Unclassified | 1045 |
| 250 | Ga0466723_002213 | 3300042618 | Bacteria | 5507 |
| 251 | Ga0466723_023643 | 3300042618 | Bacteria | 13851 |
| 252 | Ga0466726_409103 | 3300042619 | Bacteria | 26940 |
| 253 | Ga0123357_10141284 | 3300009784 | Bacteria | 2958 |
| 254 | Ga0123356_10088676 | 3300010049 | Bacteria | 2941 |
| 255 | Ga0123356_10094249 | 3300010049 | Bacteria | 2859 |
| 256 | Ga0123356_10267304 | 3300010049 | Bacteria | 1798 |
| 257 | Ga0123356_11399584 | 3300010049 | Bacteria | 860 |
| 258 | Ga0123356_11545531 | 3300010049 | Bacteria | 820 |
| 259 | Ga0123356_13704246 | 3300010049 | Unclassified | 528 |
| 260 | Ga0123353_10569863 | 3300010167 | Bacteria | 1628 |
| 261 | Ga0123353_12166120 | 3300010167 | Bacteria | 674 |
| 262 | Ga0123353_12177728 | 3300010167 | Unclassified | 672 |
| 263 | Ga0123353_13056199 | 3300010167 | Bacteria | 540 |
| 264 | Ga0466735_010594 | 3300042624 | Bacteria | 17619 |
| 265 | Ga0466702_307872 | 3300042635 | Bacteria | 1322 |
| 266 | Ga0466704_168568 | 3300042643 | Bacteria | 2768 |
| 267 | Ga0233288_1040099 | 3300022232 | Bacteria | 533 |
| 268 | Ga0255786_1031598 | 3300022815 | Bacteria | 1395 |
| 269 | Ga0255809_1024925 | 3300022820 | Bacteria | 630 |
| 270 | Ga0415639_010185 | 3300038395 | Bacteria | 1992 |
| 271 | Ga0466693_257822 | 3300042592 | Bacteria | 3092 |
| 272 | Ga0466694_045300 | 3300042594 | Bacteria | 1545 |
| 273 | AustNasuHG_c1003903 | 3300000089 | Bacteria | 5368 |
| 274 | JGI24698J34947_10000191 | 3300002449 | Bacteria | 24630 |
| 275 | JGI24698J34947_10051038 | 3300002449 | Bacteria | 2083 |
| 276 | JGI24698J34947_10171312 | 3300002449 | Bacteria | 878 |
| 277 | JGI24695J34938_10000694 | 3300002450 | Bacteria | 31746 |
| 278 | JGI24695J34938_10095586 | 3300002450 | Bacteria | 1217 |
| 279 | JGI24695J34938_10107270 | 3300002450 | Bacteria | 1139 |
| 280 | JGI24695J34938_10110990 | 3300002450 | Bacteria | 1117 |
| 281 | JGI24695J34938_10340102 | 3300002450 | Unclassified | 657 |
| 282 | JGI24699J35502_10997411 | 3300002509 | Bacteria | 1337 |
| 283 | JGI24699J35502_11094682 | 3300002509 | Bacteria | 2209 |
| 284 | Ga0072941_1089962 | 3300005201 | Bacteria | 911 |
| 285 | Ga0466707_268684 | 3300042601 | Bacteria | 1022 |
| 286 | Ga0466717_033387 | 3300042604 | Bacteria | 1473 |
| 287 | Ga0466717_121579 | 3300042604 | Bacteria | 1020 |
| 288 | Ga0466719_133246 | 3300042606 | Bacteria | 1882 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00584 | SecE | SecE/Sec61-gamma subunits of protein translocation complex | 14 | 67 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.