Protein Family IF02952

Metagenome Metatranscriptome Isolate
176 Members
85 Samples
135 Scaffolds
146.02 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10804629|Ga0123356_108046293
Length
173 aa
Sequence
MRGMEQETGQFEWSRRQGISFGGMFIMKTFMAKPESYVNKRKWYVVDAEGLPLGRLASEVARVLHGKNKPDYTPHVDTGDHVIVVNAEKVLLTGKKLDQKMYRRHSGYAGGMKEIKYRHLMERMPERAIELAVKGMLPKNSLGRQIYRKLIVYKGAEHKNQAQKPEPLALNI*

📊 Sample Types

Isolate 23.3%
Metagenome 75.0%
MAG 0.0%
Metatranscriptome 1.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 41.0%
Termitidae 28.9%
Kalotermitidae 10.8%
Drosophilidae 2.4%
Elmidae 2.4%
Rhinotermitidae 2.4%
Termopsidae 2.4%
Passalidae 2.4%
Tenebrionidae 2.4%
Hodotermitidae 1.2%
Scarabaeidae 1.2%
Stratiomyidae 1.2%
Nephropidae 1.2%

🌳 Taxonomy

Archaea 1
Bacteria 160
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
2 2864909992 Bacillus velezensis S00166 Isolate Elmidae
3 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
4 2820441105 Unclassified Firmicutes Lab288P3bin202 Isolate Unclassified
5 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
6 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
7 2820669764 Unclassified Firmicutes Co191P3bin30 Isolate Unclassified
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
15 3300021217 Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA Metatranscriptome Termitidae
16 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
17 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
18 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
19 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
20 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
21 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
22 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
23 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
24 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
25 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
26 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
27 2820935937 Unclassified Actinobacteria Emb289P1bin40 Isolate Unclassified
28 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
29 2820004052 Unclassified Synergistetes Nt197P3bin25 Isolate Unclassified
30 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
31 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
32 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
33 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
34 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
35 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
36 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
39 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
40 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
41 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
42 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
43 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
44 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
45 2820497731 Unclassified Firmicutes Lab288P1bin55 Isolate Unclassified
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
49 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
50 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
51 2864895409 Bacillus aerius S00152 Isolate Elmidae
52 2916858470 Heyndrickxia oleronia Isolate Unclassified
53 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
54 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
55 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
56 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
57 2820679524 Unclassified Firmicutes Co191P1bin94 Isolate Unclassified
58 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
59 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
60 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
61 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
62 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
63 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
64 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
65 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
66 2820613375 Unclassified Firmicutes Emb289P1bin134 Isolate Unclassified
67 2820636287 Unclassified Firmicutes Emb289P1bin112 Isolate Unclassified
68 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
69 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
70 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
71 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
72 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
73 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
74 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
75 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
76 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
77 3300021227 Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA Metatranscriptome Termitidae
78 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
79 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
80 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
81 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
82 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
83 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
84 8064008355 Heyndrickxia oleronia Isolate Unclassified
85 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_282480 3300042612 Bacteria 27901
2 Ga0466733_104376 3300042659 Bacteria 1514
3 Ga0415639_004899 3300038395 Bacteria 12664
4 Ga0415639_019906 3300038395 Bacteria 27443
5 Ga0123355_10002723 3300009826 Bacteria 25034
6 Ga0123356_10373326 3300010049 Bacteria 1557
7 Ga0123356_13730702 3300010049 Bacteria 526
8 Ga0123353_10010437 3300010167 Bacteria 12950
9 Ga0123353_10079670 3300010167 Archaea 5267
10 Ga0123353_10102632 3300010167 Bacteria 4610
11 Ga0123353_10172924 3300010167 Bacteria 3427
12 Ga0123353_10248603 3300010167 Bacteria 2756
13 Ga0123353_12379068 3300010167 Unclassified 634
14 Ga0466717_302256 3300042604 Bacteria 1891
15 Ga0466719_188481 3300042606 Bacteria 1105
16 Ga0466703_326192 3300042636 Bacteria 5797
17 2227641581 2225789004 Bacteria 2057
18 Ga0068302_10001008 3300005071 Bacteria 1452
19 Ga0466726_232487 3300042619 Bacteria 4543
20 Ga0415639_019907 3300038395 Bacteria 4906
21 Ga0466696_127352 3300042596 Bacteria 8928
22 Ga0123355_10258170 3300009826 Bacteria 2441
23 Ga0123356_12695488 3300010049 Bacteria 622
24 Ga0123353_10001891 3300010167 Bacteria 25727
25 Ga0123353_10892376 3300010167 Bacteria 1212
26 Ga0123353_12081199 3300010167 Bacteria 692
27 Ga0466706_092023 3300042599 Bacteria 5495
28 Ga0466698_115873 3300042610 Bacteria 1408
29 Ga0466697_048616 3300042611 Bacteria 1671
30 Ga0466730_043167 3300042625 Bacteria 1128
31 Ga0466704_411261 3300042643 Bacteria 5218
32 Ga0466733_128083 3300042659 Bacteria 1743
33 Ga0466723_362088 3300042618 Unclassified 11561
34 Ga0233288_1044405 3300022232 Bacteria 958
35 Ga0415639_011643 3300038395 Bacteria 11792
36 Ga0415639_076410 3300038395 Bacteria 1411
37 Ga0123355_10020833 3300009826 Bacteria 10480
38 Ga0123356_10195991 3300010049 Bacteria 2055
39 Ga0123356_10581596 3300010049 Bacteria 1283
40 Ga0123356_10649935 3300010049 Bacteria 1222
41 Ga0123356_11951892 3300010049 Bacteria 731
42 Ga0123353_10188175 3300010167 Bacteria 3262
43 Ga0123353_10296026 3300010167 Bacteria 2474
44 Ga0466707_264425 3300042601 Bacteria 1038
45 Ga0466713_154533 3300042602 Bacteria 1102
46 Ga0466714_162086 3300042603 Bacteria 2775
47 Ga0466717_002756 3300042604 Bacteria 10812
48 Ga0466730_006343 3300042625 Bacteria 1215
49 Ga0072941_1650047 3300005201 Bacteria 908
50 Ga0466726_496577 3300042619 Bacteria 1793
51 Ga0466729_043603 3300042621 Bacteria 7258
52 Ga0223687_116288 3300021217 Bacteria 646
53 Ga0415639_004593 3300038395 Bacteria 20307
54 Ga0123355_11110855 3300009826 Bacteria 821
55 Ga0123356_10000056 3300010049 Bacteria 120275
56 Ga0123356_10031337 3300010049 Unclassified 4976
57 Ga0123356_10574351 3300010049 Unclassified 1290
58 Ga0123356_13707140 3300010049 Bacteria 528
59 Ga0123353_10022046 3300010167 Bacteria 9583
60 Ga0123353_10595858 3300010167 Bacteria 1581
61 Ga0123354_10016320 3300010882 Bacteria 11635
62 Ga0466706_068968 3300042599 Unclassified 1478
63 Ga0466707_286231 3300042601 Bacteria 8108
64 IMNBL1DRAFT_c0001421 3300000062 Bacteria 17911
65 Ga0466705_096912 3300042612 Bacteria 15671
66 Ga0562378_0002 3300056814 Bacteria 3519472
67 Ga0466715_374244 3300042616 Bacteria 19262
68 Ga0466656_177353 3300042550 Bacteria 2907
69 Ga0123355_11063672 3300009826 Bacteria 848
70 Ga0123356_10618912 3300010049 Bacteria 1248
71 Ga0123353_10115406 3300010167 Bacteria 4322
72 Ga0123353_10289876 3300010167 Unclassified 2507
73 Ga0123353_10605129 3300010167 Bacteria 1565
74 Ga0123354_10423069 3300010882 Bacteria 1105
75 Ga0466719_412175 3300042606 Unclassified 2626
76 Ga0466721_154685 3300042608 Bacteria 7172
77 Ga0466722_035400 3300042609 Bacteria 82053
78 Ga0466722_058780 3300042609 Bacteria 1458
79 Ga0466729_305099 3300042621 Bacteria 3302
80 Ga0466705_292187 3300042612 Bacteria 13639
81 Ga0466723_172529 3300042618 Bacteria 3515
82 Ga0264413_131734 3300024493 Bacteria 12949
83 Ga0415639_051883 3300038395 Unclassified 6549
84 Ga0123355_10030595 3300009826 Bacteria 8726
85 Ga0123355_10092529 3300009826 Bacteria 4789
86 Ga0123355_10095225 3300009826 Bacteria 4707
87 Ga0123356_10000196 3300010049 Bacteria 69725
88 Ga0123356_10804629 3300010049 Bacteria 1111
89 Ga0123353_10066104 3300010167 Bacteria 5804
90 Ga0123353_10103439 3300010167 Bacteria 4590
91 Ga0123353_10544911 3300010167 Bacteria 1675
92 Ga0123353_11676253 3300010167 Bacteria 798
93 Ga0466701_097433 3300042598 Bacteria 1646
94 Ga0466706_283625 3300042599 Bacteria 2281
95 Ga0466707_406938 3300042601 Bacteria 47814
96 Ga0466713_126608 3300042602 Bacteria 2610
97 Ga0466719_125541 3300042606 Unclassified 17631
98 Ga0466703_374310 3300042636 Bacteria 2253
99 Ga0466724_00380 3300042649 Unclassified 1160
100 IMNBL1DRAFT_c0008274 3300000062 Bacteria 5321
101 JGI24705J35276_12232236 3300002504 Unclassified 4239
102 Ga0466733_069873 3300042659 Bacteria 1638
103 Ga0466723_216956 3300042618 Bacteria 3856
104 Ga0466728_286808 3300042620 Bacteria 1958
105 Ga0123357_10098115 3300009784 Bacteria 3788
106 Ga0123357_10316077 3300009784 Bacteria 1551
107 Ga0123355_10314037 3300009826 Bacteria 2120
108 Ga0123355_10896610 3300009826 Bacteria 964
109 Ga0123356_10142644 3300010049 Bacteria 2365
110 Ga0123353_10603589 3300010167 Bacteria 1568
111 Ga0466714_098364 3300042603 Bacteria 5951
112 Ga0466714_168598 3300042603 Bacteria 1084
113 Ga0466722_201424 3300042609 Bacteria 1313
114 Ga0466704_426592 3300042643 Unclassified 4034
115 Ga0466708_081554 3300042652 Bacteria 30455
116 JGI24702J35022_10262372 3300002462 Bacteria 1008
117 Ga0466697_115774 3300042611 Bacteria 2516
118 Ga0562376_0237 3300056857 Unclassified 108978
119 Ga0223688_1010942 3300021227 Bacteria 909
120 Ga0415639_096300 3300038395 Bacteria 6538
121 Ga0123355_10854640 3300009826 Bacteria 1000
122 Ga0123355_11189157 3300009826 Bacteria 780
123 Ga0123353_10129114 3300010167 Bacteria 4058
124 Ga0466706_037264 3300042599 Bacteria 1358
125 Ga0466719_533541 3300042606 Unclassified 1297
126 Ga0466721_007284 3300042608 Bacteria 1859
127 Ga0466721_090497 3300042608 Bacteria 167057
128 Ga0466722_022549 3300042609 Bacteria 126509
129 Ga0466722_065812 3300042609 Bacteria 1304
130 Ga0466731_152057 3300042622 Bacteria 1376
131 Ga0466731_211049 3300042622 Bacteria 2863
132 Ga0466703_381067 3300042636 Bacteria 8392
133 JGI24695J34938_10005204 3300002450 Unclassified 8215
134 JGI24702J35022_10001097 3300002462 Bacteria 16825
135 JGI24702J35022_10054506 3300002462 Bacteria 2133

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00572 Ribosomal_L13 Ribosomal protein L13 41 159 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.