Protein Family IF02936
Metagenome
Metatranscriptome
Isolate
201
Members
70
Samples
183
Scaffolds
104.11
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10582477|Ga0123356_105824771
- Length
- 99 aa
- Sequence
- MIIASVNEMPGKKYEVLGLAKGSVVQSKHVGKDFMAGLKTIVGGEIKGYTEMLDEARVIATDRMKGADAIVGVRYASAAVMQNAAEIVAYGTAVKFVD*
Sample Types
Isolate
9.0%
Metagenome
90.0%
MAG
0.0%
Metatranscriptome
1.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.8%
Unclassified
28.4%
Kalotermitidae
19.4%
Rhinotermitidae
6.0%
Termopsidae
6.0%
Passalidae
3.0%
Blaberidae
1.5%
Taxonomy
Archaea
1
Bacteria
157
Eukaryota
0
Viruses
0
Unclassified
43
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 3 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 4 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 5 | 2820681712 | Unclassified Firmicutes Co191P1bin84 | Isolate | Unclassified |
| 6 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 7 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 8 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 9 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 10 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 11 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 16 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 20 | 2820339298 | Unclassified Firmicutes Nt197P3bin68 | Isolate | Unclassified |
| 21 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 22 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 23 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 34 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 37 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 41 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 42 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 46 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 47 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 48 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 49 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 50 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 51 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 54 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 55 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 56 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 57 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 58 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 59 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 60 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 61 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 62 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 63 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 64 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 65 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 66 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 67 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 68 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 69 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 70 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_060249 | 3300042659 | Bacteria | 2418 |
| 2 | Ga0264413_113639 | 3300024493 | Bacteria | 2870 |
| 3 | Ga0415639_012729 | 3300038395 | Bacteria | 1886 |
| 4 | Ga0466691_037123 | 3300042593 | Bacteria | 7340 |
| 5 | Ga0466694_360514 | 3300042594 | Bacteria | 1071 |
| 6 | Ga0466695_211384 | 3300042595 | Bacteria | 31275 |
| 7 | Ga0123355_10020986 | 3300009826 | Bacteria | 10445 |
| 8 | Ga0123355_10074282 | 3300009826 | Unclassified | 5446 |
| 9 | Ga0123355_10246168 | 3300009826 | Bacteria | 2524 |
| 10 | Ga0123355_11777947 | 3300009826 | Unclassified | 583 |
| 11 | Ga0123356_11349057 | 3300010049 | Bacteria | 875 |
| 12 | Ga0123353_12144260 | 3300010167 | Bacteria | 678 |
| 13 | JGI24698J34947_10014206 | 3300002449 | Unclassified | 4336 |
| 14 | JGI24702J35022_10082020 | 3300002462 | Unclassified | 1748 |
| 15 | JGI24703J35330_11418759 | 3300002501 | Bacteria | 985 |
| 16 | Ga0072940_1025292 | 3300005200 | Unclassified | 1161 |
| 17 | Ga0072940_1126586 | 3300005200 | Bacteria | 1199 |
| 18 | Ga0466705_525050 | 3300042612 | Unclassified | 21069 |
| 19 | Ga0466712_016115 | 3300042614 | Bacteria | 1315 |
| 20 | Ga0466726_148225 | 3300042619 | Bacteria | 3872 |
| 21 | Ga0466735_036767 | 3300042624 | Bacteria | 1148 |
| 22 | Ga0466703_109925 | 3300042636 | Bacteria | 32972 |
| 23 | Ga0466704_301502 | 3300042643 | Bacteria | 29784 |
| 24 | Ga0466708_111835 | 3300042652 | Bacteria | 4376 |
| 25 | Ga0466708_178486 | 3300042652 | Bacteria | 1850 |
| 26 | Ga0466727_196877 | 3300042655 | Bacteria | 1163 |
| 27 | Ga0466722_035963 | 3300042609 | Bacteria | 1288 |
| 28 | Ga0466722_152093 | 3300042609 | Bacteria | 2638 |
| 29 | Ga0466732_338466 | 3300042656 | Bacteria | 2594 |
| 30 | Ga0415639_109609 | 3300038395 | Bacteria | 2829 |
| 31 | Ga0466690_004050 | 3300042590 | Bacteria | 2854 |
| 32 | Ga0466690_167092 | 3300042590 | Unclassified | 1019 |
| 33 | Ga0466692_134177 | 3300042591 | Bacteria | 1651 |
| 34 | Ga0466691_153929 | 3300042593 | Unclassified | 1486 |
| 35 | Ga0466696_170926 | 3300042596 | Bacteria | 1866 |
| 36 | Ga0466699_132677 | 3300042597 | Bacteria | 3888 |
| 37 | Ga0123355_10074718 | 3300009826 | Bacteria | 5429 |
| 38 | Ga0123355_10457825 | 3300009826 | Bacteria | 1603 |
| 39 | Ga0123355_11937902 | 3300009826 | Bacteria | 549 |
| 40 | AustNasuHG_c1005320 | 3300000089 | Unclassified | 4599 |
| 41 | JGI24698J34947_10297120 | 3300002449 | Bacteria | 584 |
| 42 | Ga0466712_061245 | 3300042614 | Unclassified | 14111 |
| 43 | Ga0466712_121721 | 3300042614 | Unclassified | 5430 |
| 44 | Ga0466712_173885 | 3300042614 | Bacteria | 11067 |
| 45 | Ga0466711_045046 | 3300042615 | Bacteria | 8362 |
| 46 | Ga0466711_182079 | 3300042615 | Unclassified | 2601 |
| 47 | Ga0466723_339390 | 3300042618 | Bacteria | 1634 |
| 48 | Ga0466726_149493 | 3300042619 | Bacteria | 1769 |
| 49 | Ga0466735_225334 | 3300042624 | Bacteria | 1841 |
| 50 | Ga0466703_250075 | 3300042636 | Bacteria | 10660 |
| 51 | Ga0466727_048816 | 3300042655 | Bacteria | 1910 |
| 52 | Ga0466727_253356 | 3300042655 | Bacteria | 1509 |
| 53 | Ga0466727_339762 | 3300042655 | Bacteria | 2139 |
| 54 | Ga0466717_083902 | 3300042604 | Bacteria | 4745 |
| 55 | Ga0466716_308397 | 3300042605 | Bacteria | 2277 |
| 56 | Ga0466720_066773 | 3300042607 | Bacteria | 1817 |
| 57 | Ga0466732_139373 | 3300042656 | Unclassified | 1972 |
| 58 | Ga0466690_252376 | 3300042590 | Bacteria | 3304 |
| 59 | Ga0466696_319523 | 3300042596 | Unclassified | 1104 |
| 60 | Ga0123355_10009416 | 3300009826 | Bacteria | 14846 |
| 61 | Ga0123355_10354279 | 3300009826 | Bacteria | 1941 |
| 62 | Ga0123355_10818458 | 3300009826 | Unclassified | 1034 |
| 63 | Ga0123355_10956357 | 3300009826 | Unclassified | 918 |
| 64 | AustNasuHG_c1000838 | 3300000089 | Bacteria | 11032 |
| 65 | JGI24698J34947_10187200 | 3300002449 | Unclassified | 822 |
| 66 | JGI24695J34938_10228785 | 3300002450 | Unclassified | 783 |
| 67 | Ga0072940_1051824 | 3300005200 | Bacteria | 1603 |
| 68 | Ga0466723_149815 | 3300042618 | Bacteria | 17280 |
| 69 | Ga0466726_063965 | 3300042619 | Unclassified | 2290 |
| 70 | Ga0466726_354563 | 3300042619 | Unclassified | 1055 |
| 71 | Ga0466728_348499 | 3300042620 | Bacteria | 1082 |
| 72 | Ga0466729_043560 | 3300042621 | Bacteria | 1014 |
| 73 | Ga0466703_321048 | 3300042636 | Bacteria | 44056 |
| 74 | Ga0466716_079232 | 3300042605 | Unclassified | 1069 |
| 75 | Ga0466719_125905 | 3300042606 | Bacteria | 11099 |
| 76 | Ga0466719_460211 | 3300042606 | Bacteria | 1012 |
| 77 | Ga0466720_139266 | 3300042607 | Bacteria | 1157 |
| 78 | Ga0466722_227896 | 3300042609 | Bacteria | 14216 |
| 79 | Ga0466732_109385 | 3300042656 | Bacteria | 1511 |
| 80 | Ga0264413_111751 | 3300024493 | Unclassified | 3132 |
| 81 | Ga0456237_0021872 | 3300041968 | Unclassified | 882 |
| 82 | Ga0466690_227364 | 3300042590 | Bacteria | 1469 |
| 83 | Ga0466692_163004 | 3300042591 | Bacteria | 30267 |
| 84 | Ga0466696_416751 | 3300042596 | Unclassified | 1206 |
| 85 | Ga0466699_421262 | 3300042597 | Bacteria | 1666 |
| 86 | Ga0123355_10538648 | 3300009826 | Bacteria | 1418 |
| 87 | Ga0123355_10985798 | 3300009826 | Unclassified | 898 |
| 88 | Ga0123355_11188268 | 3300009826 | Bacteria | 780 |
| 89 | Ga0123355_11686630 | 3300009826 | Bacteria | 605 |
| 90 | Ga0123356_10305004 | 3300010049 | Bacteria | 1699 |
| 91 | Ga0123356_10582477 | 3300010049 | Bacteria | 1282 |
| 92 | Ga0123353_10097005 | 3300010167 | Unclassified | 4751 |
| 93 | AustNasuHG_c1001009 | 3300000089 | Bacteria | 10139 |
| 94 | JGI24698J34947_10001954 | 3300002449 | Bacteria | 10990 |
| 95 | Ga0072941_1074108 | 3300005201 | Bacteria | 2181 |
| 96 | Ga0466711_080190 | 3300042615 | Bacteria | 1537 |
| 97 | Ga0466711_129317 | 3300042615 | Bacteria | 24582 |
| 98 | Ga0466726_315771 | 3300042619 | Unclassified | 1356 |
| 99 | Ga0466728_457296 | 3300042620 | Bacteria | 126268 |
| 100 | Ga0466727_259984 | 3300042655 | Bacteria | 1898 |
| 101 | Ga0466716_030994 | 3300042605 | Bacteria | 8597 |
| 102 | Ga0466716_053810 | 3300042605 | Bacteria | 1707 |
| 103 | Ga0466716_244511 | 3300042605 | Bacteria | 11044 |
| 104 | Ga0466716_444536 | 3300042605 | Bacteria | 7069 |
| 105 | Ga0466722_087874 | 3300042609 | Unclassified | 1802 |
| 106 | Ga0466705_228415 | 3300042612 | Bacteria | 12286 |
| 107 | Ga0223677_1014900 | 3300021239 | Unclassified | 743 |
| 108 | Ga0415639_044817 | 3300038395 | Bacteria | 1108 |
| 109 | Ga0466656_205442 | 3300042550 | Bacteria | 1007 |
| 110 | Ga0466692_036145 | 3300042591 | Bacteria | 11192 |
| 111 | Ga0466696_311361 | 3300042596 | Bacteria | 2164 |
| 112 | Ga0123355_10727025 | 3300009826 | Bacteria | 1130 |
| 113 | JGI24698J34947_10004689 | 3300002449 | Bacteria | 7459 |
| 114 | Ga0072941_1052030 | 3300005201 | Bacteria | 5113 |
| 115 | Ga0466726_031010 | 3300042619 | Bacteria | 3923 |
| 116 | Ga0466726_321861 | 3300042619 | Bacteria | 1368 |
| 117 | Ga0466729_028069 | 3300042621 | Bacteria | 1275 |
| 118 | Ga0466735_106240 | 3300042624 | Unclassified | 3746 |
| 119 | Ga0466730_066963 | 3300042625 | Bacteria | 3259 |
| 120 | Ga0466703_025731 | 3300042636 | Bacteria | 7379 |
| 121 | Ga0466704_179589 | 3300042643 | Unclassified | 4070 |
| 122 | Ga0466694_046914 | 3300042594 | Bacteria | 2969 |
| 123 | Ga0466694_270218 | 3300042594 | Bacteria | 3002 |
| 124 | Ga0123355_10884364 | 3300009826 | Bacteria | 975 |
| 125 | 2227593529 | 2225789004 | Unclassified | 2401 |
| 126 | JGI24698J34947_10000512 | 3300002449 | Unclassified | 18252 |
| 127 | JGI24698J34947_10002573 | 3300002449 | Bacteria | 9796 |
| 128 | JGI24698J34947_10005432 | 3300002449 | Unclassified | 6991 |
| 129 | JGI24705J35276_12006597 | 3300002504 | Bacteria | 855 |
| 130 | Ga0466712_023838 | 3300042614 | Bacteria | 27673 |
| 131 | Ga0466715_137770 | 3300042616 | Bacteria | 2131 |
| 132 | Ga0466715_539147 | 3300042616 | Bacteria | 3720 |
| 133 | Ga0466723_080143 | 3300042618 | Bacteria | 5565 |
| 134 | Ga0466723_214293 | 3300042618 | Unclassified | 1027 |
| 135 | Ga0466729_174382 | 3300042621 | Bacteria | 1139 |
| 136 | Ga0466704_249026 | 3300042643 | Unclassified | 2479 |
| 137 | Ga0466725_170215 | 3300042654 | Bacteria | 2316 |
| 138 | Ga0466727_038545 | 3300042655 | Unclassified | 3326 |
| 139 | Ga0466713_077395 | 3300042602 | Bacteria | 1900 |
| 140 | Ga0466720_028370 | 3300042607 | Bacteria | 1028 |
| 141 | Ga0466720_041328 | 3300042607 | Bacteria | 5422 |
| 142 | Ga0466722_072985 | 3300042609 | Bacteria | 33307 |
| 143 | Ga0223683_1018493 | 3300021245 | Bacteria | 719 |
| 144 | Ga0466690_430563 | 3300042590 | Bacteria | 2031 |
| 145 | Ga0466692_028359 | 3300042591 | Unclassified | 1895 |
| 146 | Ga0466693_113986 | 3300042592 | Bacteria | 32625 |
| 147 | Ga0123355_10451216 | 3300009826 | Bacteria | 1620 |
| 148 | IMNBL1DRAFT_c0005968 | 3300000062 | Archaea | 6806 |
| 149 | JGI24698J34947_10005820 | 3300002449 | Bacteria | 6759 |
| 150 | JGI24698J34947_10239761 | 3300002449 | Bacteria | 684 |
| 151 | JGI24702J35022_10458536 | 3300002462 | Bacteria | 777 |
| 152 | Ga0072940_1002692 | 3300005200 | Bacteria | 4943 |
| 153 | Ga0072941_1032198 | 3300005201 | Bacteria | 3697 |
| 154 | Ga0466705_393359 | 3300042612 | Bacteria | 10401 |
| 155 | Ga0466712_065816 | 3300042614 | Bacteria | 1376 |
| 156 | Ga0466711_112573 | 3300042615 | Bacteria | 3197 |
| 157 | Ga0466715_185144 | 3300042616 | Bacteria | 7232 |
| 158 | Ga0466723_036916 | 3300042618 | Bacteria | 2250 |
| 159 | Ga0466726_047709 | 3300042619 | Bacteria | 11387 |
| 160 | Ga0466729_230051 | 3300042621 | Bacteria | 1274 |
| 161 | Ga0466704_026742 | 3300042643 | Bacteria | 13486 |
| 162 | Ga0466704_318424 | 3300042643 | Bacteria | 13590 |
| 163 | Ga0466727_139333 | 3300042655 | Bacteria | 2415 |
| 164 | Ga0466707_296150 | 3300042601 | Bacteria | 1161 |
| 165 | Ga0466716_015042 | 3300042605 | Bacteria | 1247 |
| 166 | Ga0456237_0006607 | 3300041968 | Bacteria | 1811 |
| 167 | Ga0466690_070349 | 3300042590 | Bacteria | 2640 |
| 168 | Ga0466690_192192 | 3300042590 | Unclassified | 1765 |
| 169 | Ga0466690_319457 | 3300042590 | Bacteria | 1303 |
| 170 | Ga0466692_022918 | 3300042591 | Unclassified | 1358 |
| 171 | Ga0466696_181928 | 3300042596 | Unclassified | 1177 |
| 172 | Ga0123355_10024101 | 3300009826 | Bacteria | 9775 |
| 173 | Ga0123356_10134135 | 3300010049 | Bacteria | 2431 |
| 174 | Ga0123353_10003882 | 3300010167 | Bacteria | 19089 |
| 175 | JGI24702J35022_10012799 | 3300002462 | Bacteria | 4655 |
| 176 | Ga0068302_10074706 | 3300005071 | Bacteria | 2949 |
| 177 | Ga0072941_1261715 | 3300005201 | Bacteria | 790 |
| 178 | Ga0466712_085598 | 3300042614 | Unclassified | 2467 |
| 179 | Ga0466712_130820 | 3300042614 | Unclassified | 1167 |
| 180 | Ga0466726_200604 | 3300042619 | Bacteria | 1111 |
| 181 | Ga0466726_364051 | 3300042619 | Bacteria | 1242 |
| 182 | Ga0466704_120978 | 3300042643 | Bacteria | 4234 |
| 183 | Ga0466704_228786 | 3300042643 | Bacteria | 2546 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01906 | YbjQ_1 | Putative heavy-metal-binding | 1 | 95 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.