Protein Family IF02805

Metagenome Isolate
763 Members
294 Samples
551 Scaffolds
503.41 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10109378|Ga0123356_101093782
Length
587 aa
Sequence
VEKVAAHPADLVLEASAEAAVMSFRNLYRMQRYFHFGFXXXXSISYTSPFNMIYLVLFVHHFIINNLYAQTEFLCYTCCNKTKREVAVMKAIMTVNKCFEIDIIDPRIYGSFLEQMGRAVYSGIYEPGHKTADSKGFRNDVKDLVKGLNTTIVRYPGGNYVSGYNWEDSIGPVIDRPARLDLAWKTVESHEVGLHEFMYWANEVGIEVCMAINLGTKGVDDARNIVEYCNHPGGTYWSDLRRKNGAEKPFKIKTWCLGNEMDGPWQIGAKTAEEYGRIAAEAAKVMKLVDPDIELVVCGSSARWMYTFGAWEATVLEHTYEHVDYISLHSYYGNQKNDLPGYLAKSIDMDKFIGSVSAICDYVKATKRSDKTINLSYDEWNVWYHSNENDKKNEPWQKAPPILEDIYNFEDALLFGCLMITLLKNCDRIKIACLAQLINVIAPIMTAKGGAAWQQTTYFPFMQAASHGYGTVLRHNIDVPSYDCEEFKDVPYIEAIAVSNHEKNEIVIFAVNRSLDENAEFSVELQGFSPKNIAEFTEICGHDIKQINTDGKCPVVPVESKAASVKGNSVSATLKPLSWNVVRVAI*

πŸ“Š Sample Types

Isolate 27.4%
Metagenome 72.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 36.9%
Termitidae 15.1%
Blattidae 8.2%
Apidae 7.9%
Formicidae 6.1%
Kalotermitidae 5.4%
Muscidae 4.7%
Scarabaeidae 2.9%
Culicidae 2.2%
Rhinotermitidae 1.1%
Calliphoridae 1.1%
Termopsidae 1.1%
Tenebrionidae 1.1%
Armadillidiidae 1.1%
Passalidae 0.7%
Sarcophagidae 0.7%
Thripidae 0.4%
Anthomyiidae 0.4%
Penaeidae 0.4%
Drosophilidae 0.4%
Elmidae 0.4%
Cerambycidae 0.4%
Bombycidae 0.4%
Hodotermitidae 0.4%
Thomisidae 0.4%
Siricidae 0.4%
Curculionidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 751
Eukaryota 0
Viruses 0
Unclassified 12

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
3 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
4 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
5 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
6 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
7 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
8 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
9 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
10 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
11 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
12 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
13 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
14 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
15 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
16 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
17 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
18 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 2505679068 Isoptericola variabilis 225 Isolate Unclassified
21 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
22 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
23 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
24 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
25 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
26 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
27 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
28 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
29 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
30 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
31 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
34 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
35 8114555646 Enterococcus sp. DIV1094 Isolate
36 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
37 8082023105 Niallia sp. Man26 Isolate Penaeidae
38 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
39 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
40 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
41 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
42 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
43 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
44 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
45 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
46 2684622920 Bifidobacterium asteroides Bi_200 Isolate Unclassified
47 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
48 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
49 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
50 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
51 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
52 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
53 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
54 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
55 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
56 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
57 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
58 3006461590 Streptomyces sp. RB5 Isolate Termitidae
59 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
60 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
61 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
62 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
63 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
64 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
65 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
66 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
67 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
68 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
69 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
70 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
71 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
72 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
73 8017489919 Lactobacillus brevis EF Isolate Unclassified
74 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
75 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
76 2864909992 Bacillus velezensis S00166 Isolate Elmidae
77 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
78 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
79 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
80 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
81 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
82 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
83 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
84 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
85 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
86 2865983822 Bifidobacterium xylocopae XV2 Isolate Apidae
87 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
88 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
89 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
90 2663763384 Bifidobacterium bombi DSM 19703 Isolate Apidae
91 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
92 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
93 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
94 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
95 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
96 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
97 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
98 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
99 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
100 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
101 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
102 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
103 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
104 3300006995 Ant gut microbial communities from Cephalotes angustus, Brazil Metagenome Formicidae
105 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
106 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
107 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
108 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
109 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
110 8024982947 Bifidobacterium asteroides ESL0200 Isolate Apidae
111 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
112 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
113 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
114 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
115 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
116 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
117 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
118 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
119 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
120 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
121 2693429521 Bifidobacterium coryneforme DSM 20216 Isolate Unclassified
122 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
123 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
124 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
125 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
126 2788500098 Bombiscardovia coagulans DSM 22924 Isolate Apidae
127 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
128 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
129 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
130 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
131 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
132 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
133 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
134 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
135 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
136 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
137 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
138 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
139 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
140 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
141 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
142 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
143 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
144 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
145 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
146 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
147 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
148 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
149 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
150 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
151 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
152 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
153 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
154 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
155 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
156 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
157 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
158 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
159 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
160 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
161 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
162 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
163 2504756063 Isoptericola variabilis J5 Isolate Unclassified
164 2590828839 Clostridium sp. 1 Isolate Termitidae
165 2597490194 Bifidobacterium coryneforme LMG 18911 Isolate Apidae
166 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
167 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
168 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
169 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
170 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
171 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
172 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
173 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
174 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
175 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
176 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
177 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
178 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
179 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
180 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
181 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
182 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
183 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
184 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
185 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
186 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
187 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
188 8108568626 Enterococcus sp. DIV1094 Isolate
189 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
190 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
191 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
192 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
193 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
194 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
195 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
196 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
197 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
198 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
199 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
200 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
201 2568526170 Bifidobacterium sp. A11 Isolate Apidae
202 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
203 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
204 2593339124 Clostridium sp. 4 Isolate Termitidae
205 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
206 2684622919 Bifidobacterium asteroides Bi_199 Isolate Unclassified
207 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
208 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
209 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
210 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
211 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
212 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
213 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
214 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
215 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
216 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
217 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
218 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
219 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
220 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
221 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
222 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
223 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
224 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
225 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
226 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
227 8024984606 Bifidobacterium asteroides ESL0199 Isolate Apidae
228 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
229 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
230 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
231 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
232 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
233 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
234 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
235 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
236 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
237 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
238 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
239 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
240 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
241 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
242 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
243 2603880164 Opitutus sp. Isolate Formicidae
244 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
245 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
246 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
247 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
248 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
249 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
250 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
251 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
252 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
253 3006468911 Streptomyces sp. RB17 Isolate Termitidae
254 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
255 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
256 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
257 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
258 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
259 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
260 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
261 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
262 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
263 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
264 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
265 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
266 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
267 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
268 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
269 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
270 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
271 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
272 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
273 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
274 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
275 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
276 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
277 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
278 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
279 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
280 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
281 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
282 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
283 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
284 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
285 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
286 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
287 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
288 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
289 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
290 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
291 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
292 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
293 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
294 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_021187 3300042656 Bacteria 4632
2 Ga0562375_1933 3300056856 Bacteria 25258
3 AustNasuHG_c1000159 3300000089 Bacteria 21545
4 JGI24698J34947_10000245 3300002449 Bacteria 22718
5 JGI24698J34947_10001778 3300002449 Bacteria 11494
6 JGI24698J34947_10067707 3300002449 Bacteria 1731
7 JGI24695J34938_10000121 3300002450 Bacteria 70058
8 JGI24695J34938_10000211 3300002450 Bacteria 55384
9 JGI24695J34938_10027121 3300002450 Bacteria 2712
10 JGI24702J35022_10006316 3300002462 Bacteria 6857
11 JGI24702J35022_10016254 3300002462 Bacteria 4081
12 JGI24702J35022_10036026 3300002462 Bacteria 2645
13 CVPL010W_10000313 3300002931 Bacteria 101508
14 Ga0068305_10096308 3300005083 Bacteria 7316
15 Ga0072941_1011044 3300005201 Bacteria 9605
16 Ga0072941_1021540 3300005201 Bacteria 7283
17 Ga0160441_100052 3300012825 Bacteria 155897
18 Ga0160447_102041 3300012849 Bacteria 7386
19 Ga0264413_102987 3300024493 Bacteria 13451
20 Ga0415639_084047 3300038395 Bacteria 4107
21 Ga0466692_066250 3300042591 Bacteria 6610
22 Ga0466691_139261 3300042593 Bacteria 6974
23 Ga0466695_066136 3300042595 Bacteria 7660
24 Ga0466696_135756 3300042596 Bacteria 2941
25 Ga0466696_314001 3300042596 Bacteria 2070
26 Ga0466699_292456 3300042597 Bacteria 4296
27 Ga0466712_100168 3300042614 Bacteria 9504
28 Ga0466711_329282 3300042615 Bacteria 14711
29 Ga0466715_289164 3300042616 Bacteria 65907
30 Ga0466715_348875 3300042616 Bacteria 6675
31 Ga0466715_636290 3300042616 Bacteria 2985
32 Ga0466723_259416 3300042618 Bacteria 4800
33 Ga0466726_191170 3300042619 Bacteria 2140
34 Ga0466728_377408 3300042620 Bacteria 10780
35 Ga0123355_10000034 3300009826 Bacteria 138123
36 Ga0123355_10000136 3300009826 Bacteria 86809
37 Ga0123355_10000706 3300009826 Bacteria 45274
38 Ga0123355_10001843 3300009826 Bacteria 29687
39 Ga0123355_10040966 3300009826 Bacteria 7540
40 Ga0123355_10049113 3300009826 Bacteria 6861
41 Ga0123355_10102882 3300009826 Bacteria 4491
42 Ga0123356_10000057 3300010049 Bacteria 118961
43 Ga0123356_10001037 3300010049 Bacteria 30792
44 Ga0123356_10023120 3300010049 Bacteria 5855
45 Ga0123356_10031275 3300010049 Bacteria 4981
46 Ga0123356_10041632 3300010049 Bacteria 4280
47 Ga0123353_10000205 3300010167 Bacteria 75061
48 Ga0123353_10041743 3300010167 Bacteria 7251
49 Ga0123353_10060617 3300010167 Bacteria 6068
50 Ga0123353_10095412 3300010167 Bacteria 4792
51 Ga0123353_10402791 3300010167 Bacteria 2035
52 Ga0160466_101978 3300012809 Bacteria 4578
53 Ga0466735_183270 3300042624 Bacteria 3304
54 Ga0466703_003316 3300042636 Bacteria 8999
55 Ga0466703_140572 3300042636 Bacteria 16896
56 Ga0466703_237982 3300042636 Bacteria 1578
57 Ga0466704_083591 3300042643 Unclassified 5521
58 Ga0466704_158375 3300042643 Unclassified 2657
59 Ga0466704_558062 3300042643 Bacteria 9825
60 Ga0466709_085845 3300042648 Bacteria 11036
61 Ga0466709_347344 3300042648 Bacteria 10736
62 Ga0466706_157668 3300042599 Bacteria 30513
63 Ga0466714_087931 3300042603 Bacteria 5438
64 Ga0466716_393082 3300042605 Bacteria 13184
65 Ga0466719_078176 3300042606 Bacteria 8732
66 Ga0466719_326625 3300042606 Bacteria 2675
67 Ga0466720_020951 3300042607 Bacteria 5293
68 Ga0466720_051897 3300042607 Bacteria 27085
69 Ga0466720_154964 3300042607 Bacteria 9593
70 Ga0466721_330438 3300042608 Bacteria 4134
71 Ga0466721_330719 3300042608 Bacteria 12457
72 Ga0466698_452437 3300042610 Bacteria 4263
73 Ga0466705_140163 3300042612 Unclassified 6192
74 Ga0466732_310043 3300042656 Bacteria 9300
75 2211830538 2209111004 Bacteria 31842
76 AustNasuHG_c1019005 3300000089 Bacteria 2260
77 JGI24698J34947_10003177 3300002449 Bacteria 8900
78 JGI24698J34947_10007736 3300002449 Bacteria 5905
79 JGI24695J34938_10011556 3300002450 Bacteria 4748
80 JGI24703J35330_11748566 3300002501 Bacteria 20226
81 JGI24703J35330_11748861 3300002501 Bacteria 57790
82 JGI24700J35501_10930772 3300002508 Bacteria 23021
83 Ga0102733_100009 3300006995 Bacteria 60424
84 Ga0103260_1000016 3300007139 Bacteria 84640
85 Ga0123357_10000472 3300009784 Bacteria 39208
86 Ga0160432_101071 3300012818 Bacteria 10464
87 Ga0160441_100153 3300012825 Bacteria 74326
88 Ga0264413_102148 3300024493 Bacteria 9828
89 Ga0264413_121874 3300024493 Bacteria 2464
90 Ga0415639_023068 3300038395 Bacteria 23247
91 Ga0466690_053843 3300042590 Bacteria 8207
92 Ga0466690_276864 3300042590 Bacteria 4626
93 Ga0466692_017116 3300042591 Bacteria 11672
94 Ga0466691_147751 3300042593 Bacteria 15883
95 Ga0466694_140512 3300042594 Bacteria 34095
96 Ga0466695_292736 3300042595 Bacteria 6822
97 Ga0466696_492940 3300042596 Bacteria 10720
98 Ga0466701_008017 3300042598 Bacteria 2472
99 Ga0466705_455931 3300042612 Bacteria 16939
100 Ga0466712_267362 3300042614 Bacteria 3531
101 Ga0466715_227226 3300042616 Bacteria 9596
102 Ga0466715_305834 3300042616 Bacteria 4419
103 Ga0466715_335050 3300042616 Bacteria 38288
104 Ga0466723_313594 3300042618 Bacteria 97104
105 Ga0123355_10000076 3300009826 Bacteria 104837
106 Ga0123355_10001268 3300009826 Bacteria 35291
107 Ga0123355_10003755 3300009826 Bacteria 21956
108 Ga0123355_10013585 3300009826 Bacteria 12682
109 Ga0123355_10074581 3300009826 Bacteria 5435
110 Ga0123356_10000122 3300010049 Bacteria 85176
111 Ga0123356_10035757 3300010049 Bacteria 4637
112 Ga0123356_10249696 3300010049 Unclassified 1851
113 Ga0123353_10029414 3300010167 Bacteria 8466
114 Ga0123353_10200621 3300010167 Bacteria 3139
115 Ga0123353_10293366 3300010167 Bacteria 2488
116 Ga0123353_10297158 3300010167 Bacteria 2468
117 Ga0123353_10308489 3300010167 Bacteria 2410
118 Ga0123353_10338369 3300010167 Bacteria 2274
119 Ga0160442_100124 3300012806 Bacteria 80499
120 Ga0466734_081394 3300042623 Bacteria 1911
121 Ga0466703_145538 3300042636 Bacteria 4955
122 Ga0466703_168655 3300042636 Bacteria 15392
123 Ga0466704_119825 3300042643 Bacteria 18443
124 Ga0466709_176909 3300042648 Bacteria 12433
125 Ga0466713_016055 3300042602 Bacteria 9592
126 Ga0466713_038350 3300042602 Bacteria 35416
127 Ga0466713_090791 3300042602 Bacteria 2033
128 Ga0466716_427537 3300042605 Bacteria 1640
129 Ga0466719_560412 3300042606 Bacteria 6733
130 Ga0466721_193918 3300042608 Bacteria 2457
131 Ga0466705_113754 3300042612 Bacteria 4298
132 Ga0466705_122921 3300042612 Bacteria 2887
133 2227080806 2225789004 Bacteria 40184
134 IMNBL1DRAFT_c0010803 3300000062 Bacteria 4327
135 AustNasuHG_c1002456 3300000089 Bacteria 6706
136 JGI24698J34947_10010339 3300002449 Bacteria 5117
137 JGI24698J34947_10017760 3300002449 Bacteria 3852
138 JGI24695J34938_10048642 3300002450 Bacteria 1866
139 Ga0072941_1056165 3300005201 Bacteria 4479
140 Ga0103263_100059 3300007042 Bacteria 33606
141 Ga0102736_1000020 3300007052 Bacteria 216649
142 Ga0103261_1000009 3300007083 Bacteria 174781
143 Ga0102738_1000005 3300007141 Bacteria 120007
144 Ga0160432_100128 3300012818 Bacteria 72540
145 Ga0160432_101159 3300012818 Bacteria 9595
146 Ga0160467_100057 3300012829 Bacteria 166246
147 Ga0160455_100810 3300012837 Bacteria 12325
148 Ga0415639_056146 3300038395 Bacteria 18416
149 Ga0466693_225015 3300042592 Bacteria 39293
150 Ga0466691_006713 3300042593 Bacteria 16840
151 Ga0466694_051268 3300042594 Bacteria 15292
152 Ga0466694_130671 3300042594 Bacteria 13519
153 Ga0466694_316707 3300042594 Bacteria 4851
154 Ga0466695_197784 3300042595 Bacteria 6359
155 Ga0466699_327888 3300042597 Bacteria 2235
156 Ga0466712_274184 3300042614 Bacteria 2287
157 Ga0466712_311956 3300042614 Bacteria 4138
158 Ga0466715_136695 3300042616 Bacteria 9988
159 Ga0466718_013607 3300042617 Bacteria 2054
160 Ga0466723_005736 3300042618 Bacteria 4109
161 Ga0466723_019168 3300042618 Bacteria 39538
162 Ga0466726_142307 3300042619 Bacteria 1736
163 Ga0466729_125791 3300042621 Bacteria 4872
164 Ga0123357_10056109 3300009784 Bacteria 5300
165 Ga0123355_10000265 3300009826 Bacteria 66734
166 Ga0123355_10000436 3300009826 Bacteria 54934
167 Ga0123355_10000587 3300009826 Bacteria 49043
168 Ga0123355_10003152 3300009826 Bacteria 23530
169 Ga0123355_10212451 3300009826 Bacteria 2801
170 Ga0123355_10352174 3300009826 Bacteria 1949
171 Ga0123356_10000067 3300010049 Bacteria 109410
172 Ga0123356_10006536 3300010049 Bacteria 11743
173 Ga0123356_10052821 3300010049 Bacteria 3780
174 Ga0123356_10109378 3300010049 Bacteria 2667
175 Ga0123356_10111051 3300010049 Bacteria 2648
176 Ga0123356_10292804 3300010049 Bacteria 1729
177 Ga0123353_10000793 3300010167 Bacteria 38470
178 Ga0123353_10044442 3300010167 Bacteria 7041
179 Ga0466735_020724 3300042624 Bacteria 3066
180 Ga0466730_102528 3300042625 Bacteria 14541
181 Ga0466702_024171 3300042635 Bacteria 2086
182 Ga0466702_169110 3300042635 Bacteria 2357
183 Ga0466702_367822 3300042635 Bacteria 3058
184 Ga0466703_062064 3300042636 Bacteria 3528
185 Ga0466703_069077 3300042636 Bacteria 1695
186 Ga0466703_271349 3300042636 Bacteria 3305
187 Ga0466703_335254 3300042636 Bacteria 3323
188 Ga0466704_619953 3300042643 Bacteria 1767
189 Ga0466708_139806 3300042652 Bacteria 3093
190 Ga0466708_283354 3300042652 Bacteria 4555
191 Ga0466725_068250 3300042654 Bacteria 5387
192 Ga0466725_238253 3300042654 Bacteria 7774
193 Ga0466706_051055 3300042599 Bacteria 6884
194 Ga0466706_051861 3300042599 Bacteria 18249
195 Ga0466706_178753 3300042599 Bacteria 2077
196 Ga0466714_126813 3300042603 Bacteria 1756
197 Ga0466714_132855 3300042603 Bacteria 3145
198 Ga0466714_151586 3300042603 Bacteria 2251
199 Ga0466719_148376 3300042606 Bacteria 23878
200 Ga0466719_538435 3300042606 Bacteria 19486
201 Ga0466722_070330 3300042609 Bacteria 7644
202 Ga0466722_125264 3300042609 Bacteria 12845
203 Ga0466705_245617 3300042612 Bacteria 2195
204 Ga0466705_250522 3300042612 Bacteria 20540
205 Ga0466732_013049 3300042656 Bacteria 24009
206 IMNBL1DRAFT_c0000163 3300000062 Bacteria 59088
207 AustNasuHG_c1001470 3300000089 Bacteria 8461
208 JGI24698J34947_10000046 3300002449 Bacteria 35835
209 JGI24699J35502_11130792 3300002509 Bacteria 5285
210 Ga0102739_1000152 3300007095 Bacteria 58348
211 Ga0160470_101052 3300012813 Bacteria 7481
212 Ga0160453_100433 3300012814 Bacteria 33763
213 Ga0160441_100090 3300012825 Bacteria 110179
214 Ga0160452_100013 3300012834 Bacteria 343612
215 Ga0160446_100019 3300012835 Bacteria 236771
216 Ga0160436_1000470 3300012861 Bacteria 15740
217 Ga0264413_150466 3300024493 Bacteria 6104
218 Ga0466692_055148 3300042591 Bacteria 8551
219 Ga0466693_170563 3300042592 Bacteria 3803
220 Ga0466691_188100 3300042593 Bacteria 2859
221 Ga0466694_193860 3300042594 Bacteria 7349
222 Ga0466712_036654 3300042614 Bacteria 3887
223 Ga0466712_054753 3300042614 Bacteria 11096
224 Ga0466712_057786 3300042614 Bacteria 5339
225 Ga0466712_138776 3300042614 Bacteria 16392
226 Ga0466712_143567 3300042614 Bacteria 27408
227 Ga0466715_031756 3300042616 Bacteria 47286
228 Ga0466715_146797 3300042616 Bacteria 104288
229 Ga0466715_271193 3300042616 Bacteria 4368
230 Ga0466715_340026 3300042616 Bacteria 11937
231 Ga0466715_351341 3300042616 Bacteria 13187
232 Ga0466723_096415 3300042618 Bacteria 4245
233 Ga0466723_232110 3300042618 Bacteria 32041
234 Ga0466728_007274 3300042620 Bacteria 6822
235 Ga0466728_065700 3300042620 Bacteria 6080
236 Ga0123357_10035690 3300009784 Bacteria 6761
237 Ga0123357_10060934 3300009784 Bacteria 5059
238 Ga0123355_10000057 3300009826 Bacteria 117095
239 Ga0123355_10000261 3300009826 Bacteria 67520
240 Ga0123355_10000264 3300009826 Bacteria 66949
241 Ga0123355_10002742 3300009826 Bacteria 24969
242 Ga0123355_10017982 3300009826 Bacteria 11194
243 Ga0123355_10034234 3300009826 Bacteria 8253
244 Ga0123355_10129554 3300009826 Bacteria 3890
245 Ga0123356_10000850 3300010049 Bacteria 33979
246 Ga0123356_10003268 3300010049 Bacteria 17020
247 Ga0123356_10003424 3300010049 Bacteria 16619
248 Ga0123356_10003754 3300010049 Bacteria 15830
249 Ga0123356_10022248 3300010049 Bacteria 5988
250 Ga0123356_10025544 3300010049 Bacteria 5552
251 Ga0123356_10038812 3300010049 Bacteria 4437
252 Ga0123356_10046644 3300010049 Bacteria 4032
253 Ga0123356_10064276 3300010049 Bacteria 3431
254 Ga0123356_10073808 3300010049 Bacteria 3209
255 Ga0123356_10175143 3300010049 Bacteria 2160
256 Ga0123356_10227908 3300010049 Bacteria 1925
257 Ga0123353_10034196 3300010167 Bacteria 7929
258 Ga0123353_10065203 3300010167 Bacteria 5846
259 Ga0123353_10283613 3300010167 Bacteria 2542
260 Ga0123353_10346276 3300010167 Bacteria 2242
261 Ga0123353_10432336 3300010167 Bacteria 1946
262 Ga0123354_10067251 3300010882 Bacteria 5222
263 Ga0160466_100275 3300012809 Bacteria 33598
264 Ga0160471_100700 3300012812 Bacteria 8277
265 Ga0466704_043323 3300042643 Bacteria 77338
266 Ga0466706_182021 3300042599 Bacteria 13302
267 Ga0466706_232951 3300042599 Bacteria 2587
268 Ga0466700_280014 3300042600 Bacteria 5519
269 Ga0466700_353075 3300042600 Bacteria 1588
270 Ga0466713_107250 3300042602 Bacteria 117772
271 Ga0466716_039083 3300042605 Bacteria 7079
272 Ga0466719_262243 3300042606 Bacteria 2166
273 Ga0466720_088602 3300042607 Bacteria 3516
274 Ga0466722_025521 3300042609 Bacteria 8977
275 Ga0466722_111918 3300042609 Bacteria 1562
276 Ga0466722_141671 3300042609 Bacteria 1980
277 Ga0466698_066081 3300042610 Bacteria 5859
278 Ga0466705_012566 3300042612 Bacteria 2559
279 Ga0466733_050041 3300042659 Bacteria 7692
280 Ga0466733_203607 3300042659 Bacteria 46881
281 Ga0562378_0835 3300056814 Bacteria 41249
282 JGI24698J34947_10049417 3300002449 Bacteria 2125
283 JGI24695J34938_10000047 3300002450 Bacteria 91585
284 JGI24695J34938_10010340 3300002450 Bacteria 5115
285 JGI24702J35022_10047868 3300002462 Bacteria 2276
286 CVPL005L_10000773 3300002938 Unclassified 37926
287 Ga0102734_1000470 3300007129 Bacteria 14857
288 Ga0160453_101971 3300012814 Bacteria 5727
289 Ga0160452_100382 3300012834 Bacteria 36052
290 Ga0264413_112460 3300024493 Bacteria 4681
291 Ga0415639_060923 3300038395 Bacteria 5082
292 Ga0466690_107430 3300042590 Bacteria 9819
293 Ga0466690_123612 3300042590 Bacteria 20134
294 Ga0466690_294139 3300042590 Bacteria 7313
295 Ga0466691_067350 3300042593 Bacteria 11541
296 Ga0466691_160608 3300042593 Bacteria 12746
297 Ga0466691_220040 3300042593 Bacteria 2194
298 Ga0466694_176915 3300042594 Bacteria 9606
299 Ga0466712_128264 3300042614 Bacteria 6723
300 Ga0466712_208298 3300042614 Bacteria 7941
301 Ga0466726_114113 3300042619 Bacteria 5164
302 Ga0466726_464532 3300042619 Bacteria 1882
303 Ga0466728_088061 3300042620 Bacteria 15888
304 Ga0123357_10162470 3300009784 Bacteria 2672
305 Ga0123355_10002236 3300009826 Bacteria 27325
306 Ga0123355_10020215 3300009826 Bacteria 10625
307 Ga0123355_10055539 3300009826 Bacteria 6412
308 Ga0123355_10122402 3300009826 Bacteria 4031
309 Ga0123355_10274064 3300009826 Bacteria 2339
310 Ga0123356_10002549 3300010049 Bacteria 19464
311 Ga0123356_10003377 3300010049 Bacteria 16750
312 Ga0123356_10041677 3300010049 Bacteria 4278
313 Ga0123356_10181566 3300010049 Bacteria 2126
314 Ga0123353_10000125 3300010167 Bacteria 92229
315 Ga0123353_10000261 3300010167 Bacteria 66716
316 Ga0123353_10000527 3300010167 Bacteria 47366
317 Ga0123353_10003276 3300010167 Bacteria 20423
318 Ga0123353_10004072 3300010167 Bacteria 18733
319 Ga0123353_10011618 3300010167 Bacteria 12427
320 Ga0123353_10058407 3300010167 Bacteria 6181
321 Ga0123353_10096920 3300010167 Bacteria 4753
322 Ga0123353_10149476 3300010167 Bacteria 3730
323 Ga0123353_10195554 3300010167 Bacteria 3188
324 Ga0123354_10012581 3300010882 Bacteria 13110
325 Ga0123354_10123483 3300010882 Bacteria 3324
326 Ga0160454_100019 3300012798 Bacteria 316613
327 Ga0160442_100906 3300012806 Unclassified 4296
328 Ga0466729_306422 3300042621 Bacteria 2075
329 Ga0466735_194538 3300042624 Bacteria 15465
330 Ga0466704_217710 3300042643 Bacteria 3666
331 Ga0466704_280963 3300042643 Bacteria 68260
332 Ga0466709_116967 3300042648 Bacteria 2399
333 Ga0466725_207433 3300042654 Bacteria 3529
334 Ga0466706_271885 3300042599 Unclassified 4165
335 Ga0466700_280923 3300042600 Bacteria 2309
336 Ga0466707_036373 3300042601 Bacteria 3086
337 Ga0466714_064628 3300042603 Bacteria 2360
338 Ga0466717_242060 3300042604 Bacteria 2989
339 Ga0466716_219058 3300042605 Bacteria 5887
340 Ga0466720_092229 3300042607 Bacteria 11824
341 Ga0466720_200752 3300042607 Bacteria 4990
342 Ga0466697_242469 3300042611 Bacteria 8440
343 Ga0466733_050473 3300042659 Bacteria 2743
344 Ga0466733_218886 3300042659 Bacteria 90684
345 IMNBL1DRAFT_c0000099 3300000062 Bacteria 76643
346 JGI24698J34947_10000509 3300002449 Bacteria 18302
347 JGI24698J34947_10015836 3300002449 Bacteria 4100
348 JGI24695J34938_10000125 3300002450 Bacteria 68505
349 JGI24695J34938_10000974 3300002450 Bacteria 26074
350 JGI24695J34938_10007025 3300002450 Bacteria 6670
351 JGI24702J35022_10000693 3300002462 Bacteria 20593
352 JGI24702J35022_10005488 3300002462 Bacteria 7400
353 Ga0072941_1007559 3300005201 Bacteria 11309
354 Ga0072941_1013035 3300005201 Bacteria 11283
355 Ga0072941_1020402 3300005201 Bacteria 8886
356 Ga0074278_136184 3300005721 Bacteria 10355
357 Ga0102740_1000528 3300007140 Bacteria 10502
358 Ga0123357_10000211 3300009784 Bacteria 54763
359 Ga0160467_100287 3300012829 Bacteria 58834
360 Ga0160452_100253 3300012834 Bacteria 52400
361 Ga0264413_105281 3300024493 Bacteria 18369
362 Ga0415639_000440 3300038395 Bacteria 13270
363 Ga0415639_006616 3300038395 Bacteria 53153
364 Ga0466694_261099 3300042594 Bacteria 47857
365 Ga0466696_271952 3300042596 Bacteria 15742
366 Ga0466699_119734 3300042597 Bacteria 19415
367 Ga0466699_280030 3300042597 Bacteria 2599
368 Ga0466712_257793 3300042614 Bacteria 2265
369 Ga0466712_270210 3300042614 Bacteria 2435
370 Ga0466715_278306 3300042616 Bacteria 1795
371 Ga0466715_361542 3300042616 Bacteria 8478
372 Ga0466718_070075 3300042617 Bacteria 2303
373 Ga0466723_094940 3300042618 Bacteria 8868
374 Ga0466728_414546 3300042620 Bacteria 6459
375 Ga0466728_452144 3300042620 Bacteria 2520
376 Ga0123357_10091296 3300009784 Bacteria 3967
377 Ga0123357_10142058 3300009784 Bacteria 2946
378 Ga0123355_10002682 3300009826 Bacteria 25237
379 Ga0123355_10079535 3300009826 Bacteria 5235
380 Ga0123355_10217892 3300009826 Bacteria 2751
381 Ga0123356_10000552 3300010049 Bacteria 41500
382 Ga0123356_10000560 3300010049 Bacteria 41371
383 Ga0123353_10003032 3300010167 Bacteria 21023
384 Ga0123353_10083411 3300010167 Bacteria 5142
385 Ga0123353_10205776 3300010167 Bacteria 3092
386 Ga0123354_10008296 3300010882 Bacteria 15773
387 Ga0466702_208811 3300042635 Bacteria 1908
388 Ga0466703_204295 3300042636 Bacteria 43577
389 Ga0466704_044555 3300042643 Bacteria 5029
390 Ga0466704_105015 3300042643 Bacteria 10467
391 Ga0466704_154040 3300042643 Bacteria 7898
392 Ga0466704_522784 3300042643 Bacteria 21194
393 Ga0466708_114419 3300042652 Bacteria 6626
394 Ga0466725_065677 3300042654 Bacteria 8578
395 Ga0466701_018312 3300042598 Bacteria 3476
396 Ga0466706_041431 3300042599 Bacteria 39815
397 Ga0466706_121373 3300042599 Bacteria 45048
398 Ga0466713_120381 3300042602 Bacteria 2283
399 Ga0466714_090513 3300042603 Bacteria 4669
400 Ga0466719_070988 3300042606 Bacteria 5251
401 Ga0466719_466030 3300042606 Bacteria 16212
402 Ga0466720_148534 3300042607 Bacteria 4542
403 Ga0466705_344826 3300042612 Bacteria 16170
404 Ga0466705_355573 3300042612 Bacteria 21580
405 Ga0466733_099958 3300042659 Bacteria 13852
406 Ga0562374_0015 3300057007 Bacteria 1219565
407 2227463527 2225789004 Bacteria 25357
408 JGI24698J34947_10003147 3300002449 Bacteria 8931
409 JGI24698J34947_10057260 3300002449 Bacteria 1935
410 JGI24695J34938_10000110 3300002450 Bacteria 73179
411 JGI24695J34938_10000181 3300002450 Bacteria 58662
412 JGI24695J34938_10000578 3300002450 Bacteria 35355
413 JGI24695J34938_10001184 3300002450 Bacteria 23181
414 JGI24695J34938_10002091 3300002450 Bacteria 15652
415 JGI24695J34938_10002773 3300002450 Bacteria 12848
416 JGI24695J34938_10014327 3300002450 Bacteria 4114
417 JGI24699J35502_11130317 3300002509 Bacteria 5051
418 CVPL010W_10001931 3300002931 Bacteria 24395
419 Ga0103266_1000034 3300007067 Bacteria 63595
420 Ga0160469_100500 3300012824 Bacteria 17333
421 Ga0160430_100221 3300012852 Bacteria 41444
422 Ga0264413_125796 3300024493 Bacteria 3066
423 Ga0415639_003390 3300038395 Bacteria 3450
424 Ga0415639_008872 3300038395 Bacteria 12210
425 Ga0415639_018964 3300038395 Bacteria 9459
426 Ga0466690_075372 3300042590 Bacteria 15133
427 Ga0466699_150514 3300042597 Bacteria 1739
428 Ga0466705_404543 3300042612 Bacteria 2430
429 Ga0466712_031014 3300042614 Bacteria 22253
430 Ga0466712_206401 3300042614 Bacteria 2211
431 Ga0466711_086864 3300042615 Bacteria 4599
432 Ga0466715_107413 3300042616 Bacteria 7959
433 Ga0466715_259344 3300042616 Bacteria 5456
434 Ga0466729_065402 3300042621 Bacteria 1948
435 Ga0123357_10030677 3300009784 Bacteria 7289
436 Ga0123355_10001894 3300009826 Bacteria 29398
437 Ga0123355_10004700 3300009826 Bacteria 19859
438 Ga0123355_10008578 3300009826 Bacteria 15435
439 Ga0123355_10036148 3300009826 Bacteria 8031
440 Ga0123355_10041029 3300009826 Bacteria 7534
441 Ga0123355_10059644 3300009826 Bacteria 6163
442 Ga0123355_10080434 3300009826 Bacteria 5203
443 Ga0123355_10184250 3300009826 Bacteria 3091
444 Ga0123355_10199979 3300009826 Bacteria 2922
445 Ga0123355_10293334 3300009826 Bacteria 2228
446 Ga0123355_10322314 3300009826 Bacteria 2080
447 Ga0123356_10001341 3300010049 Bacteria 27214
448 Ga0123356_10001811 3300010049 Bacteria 23278
449 Ga0123356_10004405 3300010049 Bacteria 14551
450 Ga0123356_10007982 3300010049 Bacteria 10531
451 Ga0123356_10042198 3300010049 Bacteria 4250
452 Ga0123356_10070223 3300010049 Bacteria 3285
453 Ga0123356_10119431 3300010049 Bacteria 2561
454 Ga0123356_10120508 3300010049 Bacteria 2550
455 Ga0123353_10000148 3300010167 Bacteria 87348
456 Ga0123353_10003384 3300010167 Bacteria 20151
457 Ga0123353_10006961 3300010167 Bacteria 15203
458 Ga0123353_10104658 3300010167 Bacteria 4561
459 Ga0123353_10137651 3300010167 Bacteria 3915
460 Ga0466703_292608 3300042636 Bacteria 26490
461 Ga0466704_161605 3300042643 Bacteria 72612
462 Ga0466704_391031 3300042643 Unclassified 30326
463 Ga0466708_462981 3300042652 Bacteria 13600
464 Ga0466707_104121 3300042601 Bacteria 3503
465 Ga0466707_138885 3300042601 Bacteria 24067
466 Ga0466713_019666 3300042602 Bacteria 67660
467 Ga0466713_109927 3300042602 Bacteria 3551
468 Ga0466713_130126 3300042602 Bacteria 21012
469 Ga0466714_129116 3300042603 Bacteria 18518
470 Ga0466719_194614 3300042606 Bacteria 2516
471 Ga0466722_254077 3300042609 Bacteria 10579
472 Ga0466705_044894 3300042612 Bacteria 31249
473 Ga0466732_088241 3300042656 Bacteria 11600
474 Ga0466732_142602 3300042656 Bacteria 8670
475 Ga0466733_040836 3300042659 Bacteria 9394
476 2227164136 2225789004 Bacteria 35357
477 IMNBL1DRAFT_c0000003 3300000062 Bacteria 275310
478 HBC_ctgsDRAFT_1011170 3300000333 Unclassified 2145
479 JGI24698J34947_10001556 3300002449 Bacteria 12139
480 JGI24703J35330_11677574 3300002501 Bacteria 1781
481 Ga0072940_1012972 3300005200 Bacteria 8083
482 Ga0072941_1033861 3300005201 Bacteria 6128
483 Ga0102737_1000557 3300007142 Bacteria 26550
484 Ga0103268_1007280 3300007192 Bacteria 2259
485 Ga0160453_100785 3300012814 Bacteria 17527
486 Ga0160455_100759 3300012837 Bacteria 13001
487 Ga0160430_101860 3300012852 Bacteria 7287
488 Ga0160448_106784 3300012854 Bacteria 2813
489 Ga0415639_002694 3300038395 Bacteria 28069
490 Ga0415639_013852 3300038395 Bacteria 4418
491 Ga0415639_019917 3300038395 Bacteria 23057
492 Ga0415639_022473 3300038395 Bacteria 12542
493 Ga0415639_057424 3300038395 Bacteria 9666
494 Ga0415639_064900 3300038395 Bacteria 8648
495 Ga0466693_174290 3300042592 Bacteria 9187
496 Ga0466691_107389 3300042593 Bacteria 1857
497 Ga0466694_021559 3300042594 Bacteria 2232
498 Ga0466694_051414 3300042594 Bacteria 27699
499 Ga0466694_245660 3300042594 Bacteria 3630
500 Ga0466695_259092 3300042595 Bacteria 134193
501 Ga0466699_179621 3300042597 Bacteria 2496
502 Ga0466699_284633 3300042597 Bacteria 2083
503 Ga0466699_334537 3300042597 Bacteria 18086
504 Ga0466712_158956 3300042614 Bacteria 7545
505 Ga0466711_044074 3300042615 Bacteria 8607
506 Ga0466711_194593 3300042615 Bacteria 2461
507 Ga0466711_224359 3300042615 Bacteria 4001
508 Ga0466711_305512 3300042615 Bacteria 13938
509 Ga0466715_117709 3300042616 Bacteria 2683
510 Ga0466715_503007 3300042616 Bacteria 5017
511 Ga0466715_573431 3300042616 Bacteria 6788
512 Ga0466718_130397 3300042617 Bacteria 15122
513 Ga0466723_156949 3300042618 Bacteria 10314
514 Ga0466728_066235 3300042620 Bacteria 12417
515 Ga0466729_093575 3300042621 Bacteria 3506
516 Ga0466729_143469 3300042621 Bacteria 2666
517 Ga0123357_10005081 3300009784 Bacteria 15670
518 Ga0123355_10000707 3300009826 Bacteria 45259
519 Ga0123355_10004859 3300009826 Bacteria 19568
520 Ga0123355_10045939 3300009826 Bacteria 7103
521 Ga0123355_10134085 3300009826 Bacteria 3807
522 Ga0123355_10209219 3300009826 Bacteria 2831
523 Ga0123356_10002087 3300010049 Bacteria 21562
524 Ga0123356_10029603 3300010049 Bacteria 5127
525 Ga0123356_10033135 3300010049 Bacteria 4831
526 Ga0123356_10070866 3300010049 Bacteria 3271
527 Ga0123356_10074560 3300010049 Bacteria 3193
528 Ga0123353_10000912 3300010167 Bacteria 36036
529 Ga0123353_10003527 3300010167 Unclassified 19786
530 Ga0160465_102746 3300012803 Unclassified 3623
531 Ga0466729_312750 3300042621 Bacteria 47838
532 Ga0466734_079467 3300042623 Bacteria 1933
533 Ga0466703_011812 3300042636 Bacteria 7878
534 Ga0466703_216003 3300042636 Bacteria 1597
535 Ga0466703_390373 3300042636 Bacteria 3412
536 Ga0466704_099774 3300042643 Bacteria 4950
537 Ga0466704_153815 3300042643 Bacteria 2351
538 Ga0466704_394512 3300042643 Bacteria 2449
539 Ga0466704_614205 3300042643 Unclassified 5403
540 Ga0466724_64100 3300042649 Bacteria 707103
541 Ga0466708_151977 3300042652 Bacteria 17742
542 Ga0466727_155064 3300042655 Bacteria 2573
543 Ga0466706_213657 3300042599 Bacteria 25018
544 Ga0466713_088830 3300042602 Bacteria 2071
545 Ga0466716_103047 3300042605 Bacteria 1798
546 Ga0466720_014621 3300042607 Bacteria 102324
547 Ga0466720_036363 3300042607 Bacteria 17745
548 Ga0466720_077038 3300042607 Bacteria 19130
549 Ga0466721_341650 3300042608 Bacteria 3591
550 Ga0466722_036015 3300042609 Bacteria 11074
551 Ga0466722_080197 3300042609 Bacteria 9712

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain 378 578 0.96

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.