Protein Family IF02729

Metagenome Isolate
237 Members
66 Samples
217 Scaffolds
373.97 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10029620|Ga0123356_100296203
Length
420 aa
Sequence
MMCGLSSKTFTISLDFSTLCRFQDIVPRYILSGAQVKKGENMKANDFISILNDLGDDFYTGVPDSLLAPFIDAVVDKYGISDRHIVAANEGAAVGLAAGHYLATGKPGVVYMQNSGIGNAVNPICSLLHEKVYSIPVVFVIGWRGEPGVKDEPQHVFQGEVTLELLDCLEIPYVVVSKETDDLTDTVKEFRQYLNDGKPVAFVIQKGALSNDNKPDYSTDAEISREEALEKIFDMDDSAGESKNVYVCTTGKLSREVFEIRERQGSGHSFDFLTVGSMGHSLMIAQGIALAKPEMHVFCLDGDGAALMHLGSLAVAGVQGSKNLTHIVFNNGAHETVGGLPTVCDTLELAEVALSLGYAKTYQVDTINDLSSVLEGVKDKEGPVFIEIVCNLYSRADLGRPTTTPVQNKNDLMDYLQRK*

📊 Sample Types

Isolate 8.4%
Metagenome 91.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.4%
Unclassified 32.8%
Kalotermitidae 15.6%
Rhinotermitidae 4.7%
Aphididae 3.1%
Passalidae 3.1%
Termopsidae 3.1%
Hodotermitidae 1.6%
Formicidae 1.6%

🌳 Taxonomy

Archaea 2
Bacteria 214
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2645727860 Winslowiella iniecta B120 Isolate Aphididae
2 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
3 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
4 2820582954 Unclassified Firmicutes Emb289P3bin119 Isolate Unclassified
5 2820714932 Unclassified Fibrobacteres Nc150P4bin10 Isolate Unclassified
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
8 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
9 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
14 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
15 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
16 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
22 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
29 2820520043 Unclassified Firmicutes Lab288P1bin24 Isolate Unclassified
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
34 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
35 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
36 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
37 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
42 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
43 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
44 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
45 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
46 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
47 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
48 2648501209 Winslowiella iniecta B149 Isolate Aphididae
49 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
50 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
51 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
52 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
53 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
54 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
55 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
56 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
57 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
58 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
59 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
60 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
61 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
62 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
63 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
64 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
65 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
66 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_062718 3300042656 Bacteria 2531
2 Ga0466732_288093 3300042656 Unclassified 1560
3 AustNasuHG_c1000328 3300000089 Bacteria 16453
4 AustNasuHG_c1002481 3300000089 Bacteria 6680
5 AustNasuHG_c1009014 3300000089 Bacteria 3521
6 JGI24698J34947_10010835 3300002449 Bacteria 5003
7 JGI24698J34947_10028098 3300002449 Bacteria 2980
8 JGI24695J34938_10000001 3300002450 Bacteria 290906
9 JGI24703J35330_11748710 3300002501 Bacteria 27547
10 Ga0074263_112131 3300005485 Bacteria 7807
11 Ga0123355_10136281 3300009826 Bacteria 3770
12 Ga0123355_10174041 3300009826 Bacteria 3210
13 Ga0123355_10252103 3300009826 Bacteria 2483
14 Ga0123356_10002489 3300010049 Bacteria 19669
15 Ga0123356_10051899 3300010049 Unclassified 3814
16 Ga0123356_10067304 3300010049 Bacteria 3355
17 Ga0123356_10086003 3300010049 Unclassified 2984
18 Ga0123353_10313227 3300010167 Bacteria 2386
19 Ga0466712_160043 3300042614 Bacteria 9002
20 Ga0466712_307642 3300042614 Bacteria 17229
21 Ga0466718_028461 3300042617 Bacteria 13376
22 Ga0466726_409036 3300042619 Bacteria 3606
23 Ga0466702_395067 3300042635 Bacteria 1018
24 Ga0466708_184752 3300042652 Bacteria 1544
25 Ga0466725_104272 3300042654 Bacteria 53965
26 Ga0466727_277485 3300042655 Bacteria 3462
27 Ga0264413_100161 3300024493 Bacteria 16833
28 Ga0415639_012550 3300038395 Bacteria 72465
29 Ga0415639_032389 3300038395 Bacteria 2752
30 Ga0415639_147306 3300038395 Bacteria 3623
31 Ga0466690_063752 3300042590 Bacteria 6081
32 Ga0466694_061496 3300042594 Bacteria 16184
33 Ga0466694_268043 3300042594 Bacteria 2889
34 Ga0466699_174760 3300042597 Bacteria 2808
35 Ga0466699_220856 3300042597 Bacteria 5035
36 Ga0466706_166685 3300042599 Bacteria 15107
37 Ga0466707_067863 3300042601 Bacteria 11167
38 Ga0466720_036827 3300042607 Bacteria 40262
39 Ga0466720_059654 3300042607 Bacteria 4189
40 Ga0466720_161156 3300042607 Bacteria 16667
41 Ga0466720_219064 3300042607 Bacteria 9050
42 Ga0466705_175394 3300042612 Bacteria 2797
43 Ga0466732_111115 3300042656 Bacteria 1599
44 IMNBL1DRAFT_c0001937 3300000062 Unclassified 14937
45 AustNasuHG_c1007212 3300000089 Bacteria 3956
46 AustNasuHG_c1012595 3300000089 Bacteria 2918
47 JGI24698J34947_10021225 3300002449 Bacteria 3495
48 JGI24698J34947_10043636 3300002449 Bacteria 2298
49 JGI24695J34938_10010235 3300002450 Bacteria 5155
50 Ga0072940_1030590 3300005200 Unclassified 5865
51 Ga0072941_1058358 3300005201 Bacteria 5776
52 Ga0074263_101072 3300005485 Bacteria 3962
53 Ga0102740_1000187 3300007140 Bacteria 17388
54 Ga0123355_10000914 3300009826 Bacteria 40881
55 Ga0123355_10006563 3300009826 Bacteria 17262
56 Ga0123355_10082464 3300009826 Bacteria 5129
57 Ga0123356_10000049 3300010049 Bacteria 128747
58 Ga0123356_10001408 3300010049 Bacteria 26624
59 Ga0123356_10307894 3300010049 Bacteria 1692
60 Ga0123353_10214439 3300010167 Bacteria 3017
61 Ga0123353_10424047 3300010167 Bacteria 1970
62 Ga0466712_041387 3300042614 Bacteria 51755
63 Ga0466715_164515 3300042616 Bacteria 9896
64 Ga0466726_132220 3300042619 Bacteria 3519
65 Ga0466729_075910 3300042621 Bacteria 13586
66 Ga0466729_149566 3300042621 Bacteria 3016
67 Ga0466729_221204 3300042621 Bacteria 4555
68 Ga0264413_101393 3300024493 Bacteria 6192
69 Ga0466694_035776 3300042594 Bacteria 16615
70 Ga0466696_017205 3300042596 Unclassified 6225
71 Ga0466696_283549 3300042596 Unclassified 1804
72 Ga0466706_120035 3300042599 Bacteria 16649
73 Ga0466707_369862 3300042601 Bacteria 4745
74 Ga0466720_012895 3300042607 Bacteria 75127
75 Ga0466720_041453 3300042607 Bacteria 36391
76 Ga0466720_111137 3300042607 Bacteria 4718
77 IMNBL1DRAFT_c0000008 3300000062 Bacteria 244959
78 AustNasuHG_c1002384 3300000089 Bacteria 6792
79 AustNasuHG_c1012306 3300000089 Bacteria 2954
80 AustNasuHG_c1013810 3300000089 Bacteria 2761
81 JGI24698J34947_10003913 3300002449 Bacteria 8094
82 JGI24698J34947_10021423 3300002449 Unclassified 3477
83 JGI24696J40584_12954445 3300002834 Bacteria 2640
84 Ga0072940_1002015 3300005200 Bacteria 17958
85 Ga0072940_1077815 3300005200 Bacteria 2007
86 Ga0072941_1004700 3300005201 Bacteria 115922
87 Ga0123355_10094388 3300009826 Bacteria 4733
88 Ga0123355_10365283 3300009826 Bacteria 1897
89 Ga0123353_10077661 3300010167 Bacteria 5335
90 Ga0123353_10132046 3300010167 Bacteria 4006
91 Ga0466712_020273 3300042614 Bacteria 6228
92 Ga0466712_022976 3300042614 Bacteria 24268
93 Ga0466712_088146 3300042614 Bacteria 27823
94 Ga0466715_489741 3300042616 Bacteria 10125
95 Ga0466718_075534 3300042617 Bacteria 1895
96 Ga0466718_126395 3300042617 Bacteria 2606
97 Ga0466731_280968 3300042622 Bacteria 99887
98 Ga0466702_093657 3300042635 Bacteria 1728
99 Ga0466725_288272 3300042654 Bacteria 3317
100 Ga0264413_100160 3300024493 Unclassified 17238
101 Ga0264413_101394 3300024493 Bacteria 4763
102 Ga0264413_102350 3300024493 Bacteria 10903
103 Ga0264413_143952 3300024493 Bacteria 5331
104 Ga0415639_006384 3300038395 Bacteria 18820
105 Ga0466707_346422 3300042601 Unclassified 4802
106 Ga0466720_021975 3300042607 Bacteria 22180
107 Ga0466720_030377 3300042607 Unclassified 29394
108 Ga0466720_132612 3300042607 Bacteria 3179
109 Ga0466720_178685 3300042607 Bacteria 15888
110 Ga0466720_211375 3300042607 Bacteria 60841
111 Ga0466722_246504 3300042609 Bacteria 3395
112 AustNasuHG_c1008835 3300000089 Bacteria 3560
113 JGI24698J34947_10000289 3300002449 Bacteria 21802
114 JGI24698J34947_10018246 3300002449 Archaea 3794
115 JGI24698J34947_10052569 3300002449 Bacteria 2044
116 Ga0123355_10074723 3300009826 Bacteria 5429
117 Ga0123356_10002497 3300010049 Bacteria 19633
118 Ga0123356_10095962 3300010049 Bacteria 2835
119 Ga0123353_10000049 3300010167 Bacteria 131325
120 Ga0123353_10426692 3300010167 Bacteria 1962
121 Ga0466712_015263 3300042614 Bacteria 2624
122 Ga0466712_041086 3300042614 Bacteria 62732
123 Ga0466718_084538 3300042617 Bacteria 33255
124 Ga0466726_192504 3300042619 Archaea 2392
125 Ga0466728_155061 3300042620 Bacteria 5181
126 Ga0466727_098926 3300042655 Bacteria 1243
127 Ga0264413_100158 3300024493 Unclassified 3718
128 Ga0264413_100159 3300024493 Bacteria 14093
129 Ga0264413_113184 3300024493 Bacteria 3154
130 Ga0466706_255126 3300042599 Bacteria 3534
131 Ga0466720_021325 3300042607 Bacteria 4366
132 AustNasuHG_c1002366 3300000089 Bacteria 6820
133 AustNasuHG_c1003185 3300000089 Unclassified 5921
134 JGI24698J34947_10022291 3300002449 Bacteria 3399
135 JGI24695J34938_10000520 3300002450 Bacteria 37439
136 Ga0074263_108131 3300005485 Bacteria 1745
137 Ga0123355_10009280 3300009826 Unclassified 14943
138 Ga0123355_10013218 3300009826 Bacteria 12834
139 Ga0123356_10128164 3300010049 Bacteria 2481
140 Ga0466712_013215 3300042614 Bacteria 1897
141 Ga0466703_119488 3300042636 Bacteria 16381
142 Ga0264413_118274 3300024493 Unclassified 3162
143 Ga0415639_054613 3300038395 Bacteria 2542
144 Ga0415639_133850 3300038395 Bacteria 2798
145 Ga0466690_139231 3300042590 Bacteria 1487
146 Ga0466713_072832 3300042602 Bacteria 2318
147 Ga0466716_146429 3300042605 Bacteria 2502
148 Ga0466716_157768 3300042605 Unclassified 2736
149 Ga0466720_024476 3300042607 Bacteria 3299
150 JGI24698J34947_10006171 3300002449 Bacteria 6582
151 JGI24698J34947_10009249 3300002449 Bacteria 5405
152 JGI24702J35022_10051538 3300002462 Bacteria 2193
153 Ga0072941_1455310 3300005201 Unclassified 1801
154 Ga0123355_10000641 3300009826 Bacteria 47393
155 Ga0123355_10008193 3300009826 Bacteria 15787
156 Ga0123356_10001090 3300010049 Bacteria 30074
157 Ga0123356_10011148 3300010049 Bacteria 8775
158 Ga0466712_207477 3300042614 Bacteria 2172
159 Ga0466711_176502 3300042615 Unclassified 2019
160 Ga0466715_030009 3300042616 Bacteria 5349
161 Ga0466718_029813 3300042617 Bacteria 16333
162 Ga0466718_140130 3300042617 Bacteria 2075
163 Ga0466718_151327 3300042617 Bacteria 49244
164 Ga0466726_030569 3300042619 Bacteria 4152
165 Ga0466726_124070 3300042619 Bacteria 11251
166 Ga0466692_133145 3300042591 Bacteria 8733
167 Ga0466694_255306 3300042594 Bacteria 3775
168 Ga0466694_256167 3300042594 Unclassified 25111
169 Ga0466714_046339 3300042603 Bacteria 1828
170 2227463527 2225789004 Bacteria 25357
171 JGI24698J34947_10002693 3300002449 Bacteria 9592
172 JGI24695J34938_10000006 3300002450 Bacteria 141807
173 JGI24695J34938_10015789 3300002450 Bacteria 3863
174 Ga0072941_1035232 3300005201 Bacteria 2344
175 Ga0072941_1040881 3300005201 Bacteria 18972
176 Ga0123355_10039698 3300009826 Bacteria 7660
177 Ga0123356_10006492 3300010049 Bacteria 11786
178 Ga0123356_10029620 3300010049 Bacteria 5125
179 Ga0123356_10055648 3300010049 Bacteria 3685
180 Ga0123356_10146149 3300010049 Bacteria 2340
181 Ga0123353_10236794 3300010167 Bacteria 2841
182 Ga0466705_515292 3300042612 Bacteria 2662
183 Ga0466712_272980 3300042614 Bacteria 6584
184 Ga0466711_224376 3300042615 Bacteria 2764
185 Ga0466718_045402 3300042617 Bacteria 9198
186 Ga0466702_029933 3300042635 Bacteria 8709
187 Ga0466702_066124 3300042635 Bacteria 16938
188 Ga0466703_048707 3300042636 Bacteria 2142
189 Ga0466703_379640 3300042636 Bacteria 2865
190 Ga0264413_105627 3300024493 Bacteria 18134
191 Ga0264413_113223 3300024493 Bacteria 2209
192 Ga0264413_118999 3300024493 Bacteria 4282
193 Ga0415639_008483 3300038395 Bacteria 52570
194 Ga0466720_059792 3300042607 Bacteria 24970
195 JGI24698J34947_10024195 3300002449 Bacteria 3244
196 JGI24698J34947_10070670 3300002449 Bacteria 1679
197 Ga0068305_10013464 3300005083 Bacteria 17688
198 Ga0072940_1083881 3300005200 Bacteria 3611
199 Ga0072941_1004763 3300005201 Bacteria 94525
200 Ga0072941_1305521 3300005201 Bacteria 1261
201 Ga0123355_10138097 3300009826 Bacteria 3739
202 Ga0123355_10165421 3300009826 Bacteria 3321
203 Ga0123353_10374295 3300010167 Bacteria 2134
204 Ga0123353_10919648 3300010167 Unclassified 1188
205 Ga0466712_225275 3300042614 Bacteria 2294
206 Ga0466718_151237 3300042617 Bacteria 13316
207 Ga0466723_053769 3300042618 Bacteria 4095
208 Ga0466726_177271 3300042619 Bacteria 4122
209 Ga0466702_080011 3300042635 Bacteria 2035
210 Ga0264413_100157 3300024493 Unclassified 4399
211 Ga0264413_113721 3300024493 Bacteria 12072
212 Ga0415639_079462 3300038395 Bacteria 2255
213 Ga0466707_169809 3300042601 Bacteria 12521
214 Ga0466707_227106 3300042601 Bacteria 6822
215 Ga0466720_045223 3300042607 Bacteria 21678
216 Ga0466720_112435 3300042607 Bacteria 45324
217 Ga0466720_185331 3300042607 Bacteria 80374

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 46 161 0.92
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 251 388 0.89

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02776 GO:0030976 thiamine pyrophosphate binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.