Protein Family IF02620
Metagenome
Isolate
217
Members
76
Samples
202
Scaffolds
189.07
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10000307|Ga0123356_100003071
- Length
- 223 aa
- Sequence
- VAIVHNFKTFLTPIHNITIFFINFAANIKQVSQFMATTADFRNGLCIDYNGKPCSIVWFQHVKPGKGGAFVKVKMRNLDNGRILENTFTAGEKIDIIRIERRPYQFLYKDDTGFHFMHGETFEQIDLQEDMLDNSDLMKEGQYVEMMFHADEERVLTCELPPFVEMEVTYTEPAVKGDTASTNAQKSATLETGATIMVPLFINQGERIKVDTRDRSYAERVK*
Sample Types
Isolate
6.9%
Metagenome
93.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.9%
Unclassified
21.6%
Kalotermitidae
18.9%
Rhinotermitidae
4.1%
Termopsidae
4.1%
Passalidae
2.7%
Culicidae
1.4%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
178
Eukaryota
0
Viruses
0
Unclassified
39
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 2 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 3 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 17 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 26 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 27 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 30 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 33 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 38 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 41 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 44 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 45 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 46 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 47 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 48 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 49 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 50 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 51 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 52 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 53 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 59 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 60 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 61 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 62 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 63 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 64 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 65 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 66 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 67 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 68 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 69 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 70 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 71 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 72 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 73 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 74 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 75 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 76 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10028280 | 3300010049 | Unclassified | 5252 |
| 2 | Ga0123356_11051372 | 3300010049 | Bacteria | 983 |
| 3 | Ga0466701_100464 | 3300042598 | Unclassified | 5760 |
| 4 | Ga0466714_019019 | 3300042603 | Bacteria | 3980 |
| 5 | Ga0466722_065430 | 3300042609 | Bacteria | 2589 |
| 6 | Ga0466722_203611 | 3300042609 | Bacteria | 107234 |
| 7 | Ga0466722_231619 | 3300042609 | Bacteria | 16785 |
| 8 | Ga0466698_280396 | 3300042610 | Bacteria | 1013 |
| 9 | Ga0466657_280899 | 3300042582 | Unclassified | 2366 |
| 10 | Ga0466690_113441 | 3300042590 | Unclassified | 1950 |
| 11 | Ga0466693_035825 | 3300042592 | Bacteria | 2507 |
| 12 | Ga0466695_001241 | 3300042595 | Bacteria | 1544 |
| 13 | Ga0466696_027471 | 3300042596 | Bacteria | 17440 |
| 14 | Ga0466710_286012 | 3300042613 | Bacteria | 1013 |
| 15 | Ga0466710_397938 | 3300042613 | Bacteria | 2608 |
| 16 | Ga0466735_197808 | 3300042624 | Bacteria | 1550 |
| 17 | Ga0466703_332596 | 3300042636 | Unclassified | 1418 |
| 18 | Ga0466724_55585 | 3300042649 | Unclassified | 3348 |
| 19 | Ga0466725_406867 | 3300042654 | Bacteria | 2256 |
| 20 | Ga0466727_140759 | 3300042655 | Bacteria | 3759 |
| 21 | IMNBL1DRAFT_c0000093 | 3300000062 | Bacteria | 77928 |
| 22 | JGI24698J34947_10055278 | 3300002449 | Bacteria | 1979 |
| 23 | JGI24702J35022_10002155 | 3300002462 | Bacteria | 12143 |
| 24 | JGI24705J35276_12193877 | 3300002504 | Unclassified | 1504 |
| 25 | Ga0466697_159607 | 3300042611 | Unclassified | 2476 |
| 26 | Ga0466705_091315 | 3300042612 | Bacteria | 5422 |
| 27 | Ga0466733_211074 | 3300042659 | Bacteria | 12673 |
| 28 | Ga0123353_10001797 | 3300010167 | Bacteria | 26368 |
| 29 | Ga0123353_10471656 | 3300010167 | Bacteria | 1840 |
| 30 | Ga0123353_11622354 | 3300010167 | Unclassified | 815 |
| 31 | Ga0466701_102485 | 3300042598 | Unclassified | 1750 |
| 32 | Ga0466700_138675 | 3300042600 | Bacteria | 2509 |
| 33 | Ga0466707_000846 | 3300042601 | Bacteria | 4668 |
| 34 | Ga0466719_287429 | 3300042606 | Unclassified | 3648 |
| 35 | Ga0466722_115936 | 3300042609 | Bacteria | 15963 |
| 36 | Ga0466722_173135 | 3300042609 | Bacteria | 2188 |
| 37 | Ga0466722_173288 | 3300042609 | Bacteria | 6739 |
| 38 | Ga0466691_085889 | 3300042593 | Unclassified | 1518 |
| 39 | Ga0466696_270338 | 3300042596 | Bacteria | 15999 |
| 40 | Ga0466696_393559 | 3300042596 | Bacteria | 1512 |
| 41 | Ga0466699_366726 | 3300042597 | Bacteria | 1474 |
| 42 | Ga0466715_029878 | 3300042616 | Bacteria | 5655 |
| 43 | Ga0466723_063021 | 3300042618 | Bacteria | 19255 |
| 44 | Ga0466728_373335 | 3300042620 | Bacteria | 11157 |
| 45 | Ga0466729_220500 | 3300042621 | Bacteria | 1922 |
| 46 | Ga0466704_144314 | 3300042643 | Unclassified | 6737 |
| 47 | Ga0466704_191027 | 3300042643 | Bacteria | 94994 |
| 48 | Ga0466724_36027 | 3300042649 | Unclassified | 3380 |
| 49 | Ga0466708_049345 | 3300042652 | Bacteria | 8050 |
| 50 | Ga0466708_163034 | 3300042652 | Bacteria | 32186 |
| 51 | Ga0466727_325893 | 3300042655 | Bacteria | 9301 |
| 52 | 2227535719 | 2225789004 | Bacteria | 59646 |
| 53 | IMNBL1DRAFT_c0001271 | 3300000062 | Bacteria | 19012 |
| 54 | JGI24702J35022_10012336 | 3300002462 | Unclassified | 4754 |
| 55 | JGI24702J35022_10029751 | 3300002462 | Bacteria | 2930 |
| 56 | JGI24702J35022_10057913 | 3300002462 | Bacteria | 2069 |
| 57 | JGI24696J40584_12770306 | 3300002834 | Unclassified | 820 |
| 58 | Ga0072940_1345098 | 3300005200 | Bacteria | 1245 |
| 59 | Ga0466697_236205 | 3300042611 | Bacteria | 3262 |
| 60 | Ga0466705_235933 | 3300042612 | Bacteria | 12959 |
| 61 | Ga0466732_372101 | 3300042656 | Bacteria | 36127 |
| 62 | Ga0123357_10658895 | 3300009784 | Bacteria | 771 |
| 63 | Ga0123354_10108744 | 3300010882 | Bacteria | 3679 |
| 64 | Ga0466701_042702 | 3300042598 | Bacteria | 1490 |
| 65 | Ga0466701_062311 | 3300042598 | Bacteria | 25793 |
| 66 | Ga0466706_051635 | 3300042599 | Bacteria | 8362 |
| 67 | Ga0466719_292746 | 3300042606 | Bacteria | 2703 |
| 68 | Ga0466721_137082 | 3300042608 | Bacteria | 10391 |
| 69 | Ga0265387_1002689 | 3300024582 | Bacteria | 2491 |
| 70 | Ga0466656_002175 | 3300042550 | Bacteria | 1463 |
| 71 | Ga0466657_190267 | 3300042582 | Unclassified | 1359 |
| 72 | Ga0466695_287068 | 3300042595 | Bacteria | 2642 |
| 73 | Ga0466715_624249 | 3300042616 | Bacteria | 8773 |
| 74 | Ga0466726_250585 | 3300042619 | Bacteria | 4258 |
| 75 | Ga0466731_094638 | 3300042622 | Bacteria | 32908 |
| 76 | Ga0466709_261326 | 3300042648 | Unclassified | 4876 |
| 77 | Ga0466727_064353 | 3300042655 | Bacteria | 10913 |
| 78 | JGI24702J35022_10002194 | 3300002462 | Bacteria | 12022 |
| 79 | Ga0123357_10003992 | 3300009784 | Bacteria | 17151 |
| 80 | Ga0123353_10287249 | 3300010167 | Bacteria | 2521 |
| 81 | Ga0123353_10809563 | 3300010167 | Bacteria | 1292 |
| 82 | Ga0123354_10000620 | 3300010882 | Bacteria | 37150 |
| 83 | Ga0466701_085865 | 3300042598 | Unclassified | 1030 |
| 84 | Ga0466707_150416 | 3300042601 | Bacteria | 1310 |
| 85 | Ga0466707_222820 | 3300042601 | Bacteria | 15913 |
| 86 | Ga0466716_122955 | 3300042605 | Bacteria | 9533 |
| 87 | Ga0466722_033407 | 3300042609 | Bacteria | 22375 |
| 88 | Ga0466690_396535 | 3300042590 | Bacteria | 4080 |
| 89 | Ga0466695_355964 | 3300042595 | Bacteria | 1348 |
| 90 | Ga0466699_442002 | 3300042597 | Bacteria | 1249 |
| 91 | Ga0466710_011334 | 3300042613 | Bacteria | 1464 |
| 92 | Ga0466726_193554 | 3300042619 | Unclassified | 2695 |
| 93 | Ga0466726_298022 | 3300042619 | Bacteria | 2779 |
| 94 | Ga0466729_112437 | 3300042621 | Bacteria | 1884 |
| 95 | Ga0466734_036664 | 3300042623 | Bacteria | 1767 |
| 96 | Ga0466734_074027 | 3300042623 | Bacteria | 2628 |
| 97 | Ga0466735_016838 | 3300042624 | Bacteria | 28411 |
| 98 | Ga0466727_072509 | 3300042655 | Bacteria | 26112 |
| 99 | IMNBL1DRAFT_c0017680 | 3300000062 | Bacteria | 2990 |
| 100 | IMNBL1DRAFT_c0024966 | 3300000062 | Bacteria | 2302 |
| 101 | JGI24702J35022_10045456 | 3300002462 | Bacteria | 2340 |
| 102 | JGI24705J35276_11996079 | 3300002504 | Unclassified | 843 |
| 103 | Ga0072941_1126154 | 3300005201 | Bacteria | 4125 |
| 104 | Ga0123356_10122516 | 3300010049 | Bacteria | 2532 |
| 105 | Ga0123356_10361840 | 3300010049 | Unclassified | 1578 |
| 106 | Ga0123353_10023880 | 3300010167 | Bacteria | 9266 |
| 107 | Ga0123353_10033498 | 3300010167 | Bacteria | 8003 |
| 108 | Ga0123353_10575592 | 3300010167 | Bacteria | 1617 |
| 109 | Ga0123354_10202634 | 3300010882 | Unclassified | 2175 |
| 110 | Ga0466714_134140 | 3300042603 | Unclassified | 1653 |
| 111 | Ga0160472_100044 | 3300012839 | Bacteria | 224512 |
| 112 | Ga0466692_032622 | 3300042591 | Bacteria | 12184 |
| 113 | Ga0466691_009133 | 3300042593 | Bacteria | 18706 |
| 114 | Ga0466691_078413 | 3300042593 | Unclassified | 2194 |
| 115 | Ga0466696_135190 | 3300042596 | Bacteria | 1560 |
| 116 | Ga0466696_295385 | 3300042596 | Bacteria | 40357 |
| 117 | Ga0466711_147712 | 3300042615 | Bacteria | 31504 |
| 118 | Ga0466715_314779 | 3300042616 | Bacteria | 1012 |
| 119 | Ga0466718_099763 | 3300042617 | Bacteria | 1746 |
| 120 | Ga0466726_059354 | 3300042619 | Bacteria | 2460 |
| 121 | Ga0466726_378378 | 3300042619 | Bacteria | 1002 |
| 122 | Ga0466729_045799 | 3300042621 | Bacteria | 1253 |
| 123 | Ga0466704_071303 | 3300042643 | Unclassified | 11293 |
| 124 | Ga0466709_103105 | 3300042648 | Bacteria | 3306 |
| 125 | Ga0466727_100812 | 3300042655 | Bacteria | 10125 |
| 126 | JGI24695J34938_10003201 | 3300002450 | Bacteria | 11613 |
| 127 | JGI24699J35502_11134222 | 3300002509 | Bacteria | 70815 |
| 128 | Ga0466697_148205 | 3300042611 | Bacteria | 7655 |
| 129 | Ga0466732_164717 | 3300042656 | Bacteria | 2604 |
| 130 | Ga0466733_207991 | 3300042659 | Bacteria | 1812 |
| 131 | Ga0123354_10396386 | 3300010882 | Bacteria | 1174 |
| 132 | Ga0466717_180304 | 3300042604 | Bacteria | 3157 |
| 133 | Ga0466719_513073 | 3300042606 | Bacteria | 13858 |
| 134 | Ga0466697_005717 | 3300042611 | Bacteria | 1141 |
| 135 | Ga0466690_090067 | 3300042590 | Bacteria | 1404 |
| 136 | Ga0466690_386871 | 3300042590 | Bacteria | 5935 |
| 137 | Ga0466710_382889 | 3300042613 | Bacteria | 1502 |
| 138 | Ga0466712_256644 | 3300042614 | Unclassified | 1344 |
| 139 | Ga0466712_313585 | 3300042614 | Bacteria | 2063 |
| 140 | Ga0466711_272630 | 3300042615 | Bacteria | 10448 |
| 141 | Ga0466715_553513 | 3300042616 | Bacteria | 13120 |
| 142 | Ga0466723_204338 | 3300042618 | Bacteria | 10768 |
| 143 | Ga0466726_041545 | 3300042619 | Bacteria | 8369 |
| 144 | Ga0466728_383001 | 3300042620 | Unclassified | 3538 |
| 145 | Ga0466735_037199 | 3300042624 | Bacteria | 1147 |
| 146 | Ga0466735_059974 | 3300042624 | Bacteria | 2704 |
| 147 | Ga0466703_274253 | 3300042636 | Unclassified | 1530 |
| 148 | Ga0466724_37270 | 3300042649 | Unclassified | 2741 |
| 149 | Ga0466727_032376 | 3300042655 | Bacteria | 52244 |
| 150 | Ga0466727_326592 | 3300042655 | Bacteria | 11026 |
| 151 | 2227365289 | 2225789004 | Bacteria | 1121 |
| 152 | 2227480171 | 2225789004 | Bacteria | 93917 |
| 153 | JGI24702J35022_10015190 | 3300002462 | Bacteria | 4241 |
| 154 | Ga0072941_1094460 | 3300005201 | Bacteria | 2441 |
| 155 | Ga0466705_051906 | 3300042612 | Bacteria | 7505 |
| 156 | Ga0123356_10000307 | 3300010049 | Bacteria | 55981 |
| 157 | Ga0123356_10378269 | 3300010049 | Bacteria | 1548 |
| 158 | Ga0123353_10518825 | 3300010167 | Bacteria | 1729 |
| 159 | Ga0123354_10398412 | 3300010882 | Unclassified | 1168 |
| 160 | Ga0466707_042117 | 3300042601 | Bacteria | 143034 |
| 161 | Ga0466707_049760 | 3300042601 | Bacteria | 12161 |
| 162 | Ga0466714_073411 | 3300042603 | Bacteria | 3490 |
| 163 | Ga0466716_242552 | 3300042605 | Bacteria | 13235 |
| 164 | Ga0466719_191975 | 3300042606 | Unclassified | 1477 |
| 165 | Ga0466720_127594 | 3300042607 | Bacteria | 4029 |
| 166 | Ga0466720_129111 | 3300042607 | Bacteria | 2885 |
| 167 | Ga0466722_175913 | 3300042609 | Bacteria | 10949 |
| 168 | Ga0466692_031989 | 3300042591 | Bacteria | 1443 |
| 169 | Ga0466692_032256 | 3300042591 | Bacteria | 11879 |
| 170 | Ga0466696_025874 | 3300042596 | Bacteria | 7999 |
| 171 | Ga0466705_441924 | 3300042612 | Bacteria | 10549 |
| 172 | Ga0466710_206831 | 3300042613 | Bacteria | 1065 |
| 173 | Ga0466712_201320 | 3300042614 | Bacteria | 1086 |
| 174 | Ga0466711_281256 | 3300042615 | Bacteria | 2935 |
| 175 | Ga0466715_079130 | 3300042616 | Bacteria | 6107 |
| 176 | Ga0466715_314852 | 3300042616 | Unclassified | 5190 |
| 177 | Ga0466735_094944 | 3300042624 | Bacteria | 1264 |
| 178 | Ga0466704_452371 | 3300042643 | Unclassified | 1179 |
| 179 | Ga0466709_089676 | 3300042648 | Unclassified | 4874 |
| 180 | Ga0466708_404961 | 3300042652 | Bacteria | 10101 |
| 181 | Ga0466727_236296 | 3300042655 | Bacteria | 8613 |
| 182 | JGI24702J35022_10052149 | 3300002462 | Bacteria | 2180 |
| 183 | JGI24705J35276_11874454 | 3300002504 | Bacteria | 732 |
| 184 | JGI24705J35276_12238434 | 3300002504 | Bacteria | 22055 |
| 185 | Ga0466705_203407 | 3300042612 | Bacteria | 8270 |
| 186 | Ga0466733_182681 | 3300042659 | Bacteria | 7875 |
| 187 | Ga0123353_10000888 | 3300010167 | Bacteria | 36529 |
| 188 | Ga0123353_10007038 | 3300010167 | Bacteria | 15129 |
| 189 | Ga0466701_045495 | 3300042598 | Bacteria | 33587 |
| 190 | Ga0466700_493143 | 3300042600 | Bacteria | 1738 |
| 191 | Ga0466690_063463 | 3300042590 | Bacteria | 11442 |
| 192 | Ga0466690_269988 | 3300042590 | Bacteria | 10478 |
| 193 | Ga0466694_028485 | 3300042594 | Unclassified | 3402 |
| 194 | Ga0466694_198717 | 3300042594 | Bacteria | 1053 |
| 195 | Ga0466710_371080 | 3300042613 | Unclassified | 1383 |
| 196 | Ga0466710_386932 | 3300042613 | Bacteria | 14065 |
| 197 | Ga0466723_177221 | 3300042618 | Bacteria | 14498 |
| 198 | Ga0466728_417200 | 3300042620 | Unclassified | 3100 |
| 199 | Ga0466731_055716 | 3300042622 | Bacteria | 1100 |
| 200 | Ga0466735_160449 | 3300042624 | Bacteria | 1609 |
| 201 | Ga0466703_018247 | 3300042636 | Unclassified | 9908 |
| 202 | IMNBL1DRAFT_c0027168 | 3300000062 | Bacteria | 2158 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.