Protein Family IF02617
Metagenome
Isolate
251
Members
88
Samples
220
Scaffolds
242.72
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10000260|Ga0123356_1000026034
- Length
- 278 aa
- Sequence
- MLASETEGITLQAKTPAGLDPKEAEIYRRLDPARLPKHIAIIMDGNGRWARKRHLPRVAGHRAGVTSVRYVVECASRIGIPSLTLYAFSEENWKRRPKAEVDFLMKLLSRYLKQEVPTLHKNNVRLEYIGRLHELPSFVQEKMEWAREETARNRGMLLTLALNYSARSELVDAFKSLLDGAANNGGIEHLKINEEAVSRHLYTSHLPDPDLVIRTSGEMRLSNFLLWQLAYAEIYVTPTLWPEFRGTHLLEGIAEYQKRDRRYGGLNDSSSVRALRS*
Sample Types
Isolate
12.3%
Metagenome
87.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
36.5%
Termitidae
27.1%
Kalotermitidae
14.1%
Formicidae
9.4%
Passalidae
3.5%
Rhinotermitidae
2.4%
Elmidae
1.2%
Aphididae
1.2%
Culicidae
1.2%
Termopsidae
1.2%
Apidae
1.2%
Hodotermitidae
1.2%
Taxonomy
Archaea
0
Bacteria
242
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 4 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 5 | 3300038942 | Host-associated microbial communities from haemolymph of Banana aphid from Africa - Madagascar | Metagenome | Aphididae |
| 6 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 7 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 8 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 9 | 2820183396 | Unclassified Planctomycetes Lab288P3bin214 | Isolate | Unclassified |
| 10 | 2820201435 | Unclassified Planctomycetes Cu122P5bin25 | Isolate | Unclassified |
| 11 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 12 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 13 | 2820137450 | Unclassified Proteobacteria Emb289P3bin120 | Isolate | Unclassified |
| 14 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 15 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 19 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 20 | 2820185449 | Unclassified Planctomycetes Lab288P3bin146 | Isolate | Unclassified |
| 21 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 22 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 26 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 27 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 28 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 29 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 30 | 2820196379 | Unclassified Planctomycetes Emb289P3bin158 | Isolate | Unclassified |
| 31 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 37 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 40 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 41 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 42 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 43 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 44 | 2820633305 | Unclassified Firmicutes Emb289P1bin118 | Isolate | Unclassified |
| 45 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 46 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 47 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 48 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 49 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 50 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 51 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 52 | 3300028918 | Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 | Metagenome | Formicidae |
| 53 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 54 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 55 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 56 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 57 | 2820711732 | Unclassified Firmicutes Co191P1bin26 | Isolate | Unclassified |
| 58 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 59 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 60 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 62 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 63 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 64 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 65 | 2820636287 | Unclassified Firmicutes Emb289P1bin112 | Isolate | Unclassified |
| 66 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 67 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 68 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 69 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 70 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 71 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 72 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 73 | 2820205024 | Unclassified Planctomycetes Cu122P4bin3 | Isolate | Unclassified |
| 74 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 75 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 76 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 77 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 78 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 79 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 80 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 81 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 82 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 83 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 84 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 85 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 86 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 87 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 88 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_023895 | 3300042659 | Bacteria | 2979 |
| 2 | Ga0466733_058626 | 3300042659 | Bacteria | 1515 |
| 3 | Ga0466711_191150 | 3300042615 | Bacteria | 9848 |
| 4 | Ga0466715_337271 | 3300042616 | Bacteria | 6763 |
| 5 | Ga0466723_076445 | 3300042618 | Bacteria | 10021 |
| 6 | Ga0466716_509672 | 3300042605 | Bacteria | 4664 |
| 7 | Ga0466719_354122 | 3300042606 | Bacteria | 56234 |
| 8 | Ga0120204_000015 | 3300038942 | Bacteria | 8859 |
| 9 | Ga0466690_314770 | 3300042590 | Bacteria | 4158 |
| 10 | Ga0466695_137746 | 3300042595 | Bacteria | 2317 |
| 11 | IMNBL1DRAFT_c0000440 | 3300000062 | Bacteria | 34886 |
| 12 | JGI24702J35022_10088639 | 3300002462 | Bacteria | 1681 |
| 13 | CVPL010W_10002932 | 3300002931 | Bacteria | 40505 |
| 14 | Ga0103264_1000246 | 3300007188 | Bacteria | 50384 |
| 15 | Ga0123355_10004853 | 3300009826 | Bacteria | 19577 |
| 16 | Ga0123355_10028971 | 3300009826 | Bacteria | 8957 |
| 17 | Ga0123355_10149877 | 3300009826 | Bacteria | 3546 |
| 18 | Ga0123355_10367347 | 3300009826 | Bacteria | 1889 |
| 19 | Ga0123356_10612812 | 3300010049 | Bacteria | 1254 |
| 20 | Ga0123356_10638037 | 3300010049 | Bacteria | 1232 |
| 21 | Ga0123356_11093326 | 3300010049 | Bacteria | 966 |
| 22 | Ga0123353_10004722 | 3300010167 | Bacteria | 17643 |
| 23 | Ga0123353_10027661 | 3300010167 | Bacteria | 8695 |
| 24 | Ga0123353_10457402 | 3300010167 | Bacteria | 1877 |
| 25 | Ga0123353_10492872 | 3300010167 | Bacteria | 1788 |
| 26 | Ga0466703_162466 | 3300042636 | Bacteria | 21407 |
| 27 | Ga0466704_421435 | 3300042643 | Bacteria | 2117 |
| 28 | Ga0466708_009532 | 3300042652 | Bacteria | 8018 |
| 29 | Ga0466725_039868 | 3300042654 | Bacteria | 1286 |
| 30 | Ga0466725_080853 | 3300042654 | Bacteria | 2932 |
| 31 | Ga0466715_476313 | 3300042616 | Bacteria | 1399 |
| 32 | Ga0466718_158439 | 3300042617 | Bacteria | 1139 |
| 33 | Ga0466726_196772 | 3300042619 | Bacteria | 1207 |
| 34 | Ga0466714_147564 | 3300042603 | Bacteria | 7594 |
| 35 | Ga0466716_527980 | 3300042605 | Bacteria | 2327 |
| 36 | Ga0466722_175631 | 3300042609 | Bacteria | 2086 |
| 37 | Ga0309904_1000006 | 3300029810 | Bacteria | 54211 |
| 38 | Ga0316159_10291 | 3300030930 | Bacteria | 18722 |
| 39 | Ga0466691_190380 | 3300042593 | Bacteria | 4737 |
| 40 | 2227041496 | 2225789003 | Bacteria | 4177 |
| 41 | 2227422480 | 2225789004 | Bacteria | 5619 |
| 42 | AustNasuHG_c1005743 | 3300000089 | Bacteria | 4434 |
| 43 | JGI24702J35022_10008549 | 3300002462 | Bacteria | 5791 |
| 44 | JGI24702J35022_10131030 | 3300002462 | Bacteria | 1392 |
| 45 | JGI24702J35022_10263076 | 3300002462 | Bacteria | 1007 |
| 46 | JGI24700J35501_10930904 | 3300002508 | Bacteria | 39244 |
| 47 | CVPL010W_10000311 | 3300002931 | Bacteria | 47515 |
| 48 | Ga0103264_1000531 | 3300007188 | Bacteria | 35959 |
| 49 | Ga0103264_1000672 | 3300007188 | Bacteria | 18271 |
| 50 | Ga0123357_10254768 | 3300009784 | Bacteria | 1869 |
| 51 | Ga0123355_10000824 | 3300009826 | Bacteria | 42534 |
| 52 | Ga0123355_10001238 | 3300009826 | Bacteria | 35605 |
| 53 | Ga0123355_10028701 | 3300009826 | Bacteria | 8998 |
| 54 | Ga0123355_10041008 | 3300009826 | Bacteria | 7536 |
| 55 | Ga0123355_10408130 | 3300009826 | Bacteria | 1746 |
| 56 | Ga0123356_10000260 | 3300010049 | Bacteria | 60858 |
| 57 | Ga0123356_10022993 | 3300010049 | Bacteria | 5876 |
| 58 | Ga0123356_10048812 | 3300010049 | Bacteria | 3939 |
| 59 | Ga0123353_10001612 | 3300010167 | Bacteria | 27806 |
| 60 | Ga0123353_10002163 | 3300010167 | Bacteria | 24290 |
| 61 | Ga0123353_10007246 | 3300010167 | Bacteria | 14950 |
| 62 | Ga0123353_10018103 | 3300010167 | Bacteria | 10399 |
| 63 | Ga0123353_10021537 | 3300010167 | Bacteria | 9678 |
| 64 | Ga0123353_10207976 | 3300010167 | Bacteria | 3071 |
| 65 | Ga0123353_10892047 | 3300010167 | Bacteria | 1212 |
| 66 | Ga0123354_10178265 | 3300010882 | Bacteria | 2438 |
| 67 | Ga0160454_100018 | 3300012798 | Bacteria | 326271 |
| 68 | Ga0466734_043674 | 3300042623 | Bacteria | 2162 |
| 69 | Ga0466704_280959 | 3300042643 | Bacteria | 15531 |
| 70 | Ga0466705_377825 | 3300042612 | Bacteria | 346954 |
| 71 | Ga0466733_205404 | 3300042659 | Bacteria | 1589 |
| 72 | Ga0466705_512865 | 3300042612 | Bacteria | 5576 |
| 73 | Ga0466706_022305 | 3300042599 | Bacteria | 3212 |
| 74 | Ga0466713_112912 | 3300042602 | Bacteria | 1003 |
| 75 | Ga0466714_030858 | 3300042603 | Bacteria | 8086 |
| 76 | Ga0466714_053498 | 3300042603 | Bacteria | 25725 |
| 77 | Ga0466714_082021 | 3300042603 | Bacteria | 2470 |
| 78 | Ga0466722_166978 | 3300042609 | Bacteria | 4449 |
| 79 | Ga0466722_242957 | 3300042609 | Bacteria | 1962 |
| 80 | Ga0466691_044874 | 3300042593 | Bacteria | 11053 |
| 81 | Ga0466695_100528 | 3300042595 | Bacteria | 1149 |
| 82 | Ga0466695_182693 | 3300042595 | Bacteria | 1088 |
| 83 | JGI24695J34938_10012808 | 3300002450 | Bacteria | 4430 |
| 84 | Ga0072940_1103318 | 3300005200 | Bacteria | 3289 |
| 85 | Ga0103266_1000096 | 3300007067 | Bacteria | 65436 |
| 86 | Ga0127649_104004 | 3300009460 | Bacteria | 43415 |
| 87 | Ga0123355_10000084 | 3300009826 | Bacteria | 98802 |
| 88 | Ga0123355_10007306 | 3300009826 | Bacteria | 16533 |
| 89 | Ga0123355_10430027 | 3300009826 | Bacteria | 1680 |
| 90 | Ga0123355_10522288 | 3300009826 | Bacteria | 1452 |
| 91 | Ga0123355_11018684 | 3300009826 | Bacteria | 876 |
| 92 | Ga0123356_10119421 | 3300010049 | Bacteria | 2561 |
| 93 | Ga0123356_11307112 | 3300010049 | Bacteria | 888 |
| 94 | Ga0123353_10017589 | 3300010167 | Bacteria | 10519 |
| 95 | Ga0123353_10182733 | 3300010167 | Bacteria | 3318 |
| 96 | Ga0123353_10204718 | 3300010167 | Bacteria | 3101 |
| 97 | Ga0123353_10274297 | 3300010167 | Bacteria | 2595 |
| 98 | Ga0123353_10293062 | 3300010167 | Bacteria | 2489 |
| 99 | Ga0123353_10642177 | 3300010167 | Bacteria | 1505 |
| 100 | Ga0123353_11085107 | 3300010167 | Bacteria | 1065 |
| 101 | Ga0123354_10064526 | 3300010882 | Bacteria | 5370 |
| 102 | Ga0123354_10282048 | 3300010882 | Bacteria | 1611 |
| 103 | Ga0466702_379567 | 3300042635 | Bacteria | 3902 |
| 104 | Ga0466704_192868 | 3300042643 | Bacteria | 1630 |
| 105 | Ga0466705_304963 | 3300042612 | Bacteria | 11876 |
| 106 | Ga0466715_435235 | 3300042616 | Bacteria | 17365 |
| 107 | Ga0466723_115193 | 3300042618 | Bacteria | 3429 |
| 108 | Ga0466723_156801 | 3300042618 | Bacteria | 3103 |
| 109 | Ga0466723_184354 | 3300042618 | Bacteria | 1760 |
| 110 | Ga0466707_027898 | 3300042601 | Bacteria | 18442 |
| 111 | Ga0264413_153647 | 3300024493 | Bacteria | 3264 |
| 112 | Ga0415639_028868 | 3300038395 | Bacteria | 1758 |
| 113 | Ga0466695_120877 | 3300042595 | Bacteria | 2012 |
| 114 | Ga0466696_295273 | 3300042596 | Bacteria | 3159 |
| 115 | Ga0466696_429533 | 3300042596 | Bacteria | 13931 |
| 116 | 2227507960 | 2225789004 | Bacteria | 65507 |
| 117 | Ga0123355_10142734 | 3300009826 | Bacteria | 3659 |
| 118 | Ga0123355_10174213 | 3300009826 | Bacteria | 3208 |
| 119 | Ga0123356_10010953 | 3300010049 | Bacteria | 8857 |
| 120 | Ga0123356_10231891 | 3300010049 | Bacteria | 1911 |
| 121 | Ga0123356_10296636 | 3300010049 | Bacteria | 1720 |
| 122 | Ga0123356_10922862 | 3300010049 | Bacteria | 1044 |
| 123 | Ga0123353_10086259 | 3300010167 | Bacteria | 5055 |
| 124 | Ga0466703_101912 | 3300042636 | Bacteria | 8336 |
| 125 | Ga0466703_327177 | 3300042636 | Bacteria | 5305 |
| 126 | Ga0466704_121419 | 3300042643 | Bacteria | 8439 |
| 127 | Ga0466704_572740 | 3300042643 | Bacteria | 24786 |
| 128 | Ga0466725_254383 | 3300042654 | Bacteria | 2535 |
| 129 | Ga0466705_104868 | 3300042612 | Bacteria | 11970 |
| 130 | Ga0466705_205040 | 3300042612 | Bacteria | 24843 |
| 131 | Ga0466711_346319 | 3300042615 | Bacteria | 3328 |
| 132 | Ga0466715_128238 | 3300042616 | Bacteria | 35887 |
| 133 | Ga0466715_390064 | 3300042616 | Bacteria | 2376 |
| 134 | Ga0466706_097499 | 3300042599 | Bacteria | 2015 |
| 135 | Ga0309903_100006 | 3300029809 | Bacteria | 89427 |
| 136 | Ga0466692_145386 | 3300042591 | Bacteria | 52475 |
| 137 | Ga0466696_145712 | 3300042596 | Bacteria | 2441 |
| 138 | JGI24696J40584_12961120 | 3300002834 | Bacteria | 10943 |
| 139 | Ga0123355_10025354 | 3300009826 | Bacteria | 9544 |
| 140 | Ga0123355_10247962 | 3300009826 | Bacteria | 2512 |
| 141 | Ga0123356_10789270 | 3300010049 | Bacteria | 1121 |
| 142 | Ga0123353_10000316 | 3300010167 | Bacteria | 59704 |
| 143 | Ga0123353_10000325 | 3300010167 | Bacteria | 59044 |
| 144 | Ga0123353_10027831 | 3300010167 | Unclassified | 8669 |
| 145 | Ga0123353_10305875 | 3300010167 | Bacteria | 2423 |
| 146 | Ga0123354_10008024 | 3300010882 | Bacteria | 16017 |
| 147 | Ga0466703_201753 | 3300042636 | Bacteria | 18576 |
| 148 | Ga0466705_465186 | 3300042612 | Bacteria | 12162 |
| 149 | Ga0466700_228614 | 3300042600 | Bacteria | 4114 |
| 150 | Ga0466707_163801 | 3300042601 | Bacteria | 828024 |
| 151 | Ga0466713_060399 | 3300042602 | Bacteria | 52732 |
| 152 | Ga0466717_034095 | 3300042604 | Bacteria | 1115 |
| 153 | JGI24705J35276_12228996 | 3300002504 | Bacteria | 3299 |
| 154 | JGI24696J40584_12958180 | 3300002834 | Bacteria | 3944 |
| 155 | Ga0123355_10143446 | 3300009826 | Bacteria | 3648 |
| 156 | Ga0123355_10184783 | 3300009826 | Bacteria | 3085 |
| 157 | Ga0123355_10573070 | 3300009826 | Bacteria | 1353 |
| 158 | Ga0123356_10092027 | 3300010049 | Bacteria | 2891 |
| 159 | Ga0123353_10022842 | 3300010167 | Bacteria | 9449 |
| 160 | Ga0123353_10047404 | 3300010167 | Bacteria | 6834 |
| 161 | Ga0123353_10085254 | 3300010167 | Bacteria | 5087 |
| 162 | Ga0123353_10120721 | 3300010167 | Bacteria | 4214 |
| 163 | Ga0123353_10174890 | 3300010167 | Unclassified | 3405 |
| 164 | Ga0123353_10293559 | 3300010167 | Bacteria | 2487 |
| 165 | Ga0160471_104826 | 3300012812 | Bacteria | 1851 |
| 166 | Ga0466703_107483 | 3300042636 | Bacteria | 9438 |
| 167 | Ga0466725_251328 | 3300042654 | Bacteria | 13175 |
| 168 | Ga0466733_023672 | 3300042659 | Bacteria | 1227 |
| 169 | Ga0466733_112500 | 3300042659 | Bacteria | 2815 |
| 170 | Ga0466710_290726 | 3300042613 | Bacteria | 60149 |
| 171 | Ga0466711_269110 | 3300042615 | Bacteria | 49109 |
| 172 | Ga0466718_006335 | 3300042617 | Bacteria | 1828 |
| 173 | Ga0466723_263978 | 3300042618 | Bacteria | 38111 |
| 174 | Ga0466722_098533 | 3300042609 | Bacteria | 22945 |
| 175 | Ga0309901_1000013 | 3300028918 | Bacteria | 346588 |
| 176 | IMNBL1DRAFT_c0000004 | 3300000062 | Bacteria | 271062 |
| 177 | IMNBL1DRAFT_c0033554 | 3300000062 | Bacteria | 1836 |
| 178 | CVPL010W_10000106 | 3300002931 | Bacteria | 61515 |
| 179 | Ga0072940_1234664 | 3300005200 | Bacteria | 3374 |
| 180 | Ga0103268_1008114 | 3300007192 | Bacteria | 2156 |
| 181 | Ga0123357_10212616 | 3300009784 | Bacteria | 2168 |
| 182 | Ga0123355_10000985 | 3300009826 | Bacteria | 39554 |
| 183 | Ga0123355_10054417 | 3300009826 | Unclassified | 6484 |
| 184 | Ga0123355_10134266 | 3300009826 | Bacteria | 3804 |
| 185 | Ga0123355_10299715 | 3300009826 | Bacteria | 2193 |
| 186 | Ga0123355_10480465 | 3300009826 | Bacteria | 1546 |
| 187 | Ga0123356_10027316 | 3300010049 | Unclassified | 5349 |
| 188 | Ga0123356_10059171 | 3300010049 | Unclassified | 3574 |
| 189 | Ga0123353_10010475 | 3300010167 | Unclassified | 12924 |
| 190 | Ga0466734_084274 | 3300042623 | Bacteria | 1035 |
| 191 | Ga0466703_023563 | 3300042636 | Bacteria | 17295 |
| 192 | Ga0466708_070643 | 3300042652 | Bacteria | 6570 |
| 193 | Ga0466708_387544 | 3300042652 | Bacteria | 2187 |
| 194 | Ga0466711_218509 | 3300042615 | Bacteria | 19081 |
| 195 | Ga0466723_345366 | 3300042618 | Bacteria | 19928 |
| 196 | Ga0466706_072024 | 3300042599 | Bacteria | 1708 |
| 197 | Ga0466706_240241 | 3300042599 | Bacteria | 1484 |
| 198 | Ga0466707_111198 | 3300042601 | Bacteria | 45963 |
| 199 | Ga0466714_052229 | 3300042603 | Unclassified | 3541 |
| 200 | Ga0466692_040528 | 3300042591 | Bacteria | 123812 |
| 201 | IMNBL1DRAFT_c0000007 | 3300000062 | Bacteria | 246638 |
| 202 | IMNBL1DRAFT_c0034416 | 3300000062 | Bacteria | 1803 |
| 203 | CVPL010W_10000035 | 3300002931 | Bacteria | 76263 |
| 204 | CVPL010W_10003917 | 3300002931 | Bacteria | 16841 |
| 205 | Ga0123355_10007896 | 3300009826 | Bacteria | 16029 |
| 206 | Ga0123355_10068929 | 3300009826 | Bacteria | 5688 |
| 207 | Ga0123355_10215123 | 3300009826 | Unclassified | 2776 |
| 208 | Ga0123355_10327365 | 3300009826 | Bacteria | 2057 |
| 209 | Ga0123356_10003771 | 3300010049 | Unclassified | 15783 |
| 210 | Ga0123356_10011879 | 3300010049 | Bacteria | 8476 |
| 211 | Ga0123353_10023475 | 3300010167 | Bacteria | 9340 |
| 212 | Ga0123353_10071439 | 3300010167 | Bacteria | 5577 |
| 213 | Ga0123353_10214940 | 3300010167 | Bacteria | 3012 |
| 214 | Ga0123353_10295398 | 3300010167 | Bacteria | 2477 |
| 215 | Ga0123353_10305568 | 3300010167 | Bacteria | 2425 |
| 216 | Ga0123353_10337566 | 3300010167 | Bacteria | 2278 |
| 217 | Ga0123353_10634599 | 3300010167 | Bacteria | 1517 |
| 218 | Ga0123353_10927633 | 3300010167 | Bacteria | 1181 |
| 219 | Ga0466703_052385 | 3300042636 | Bacteria | 263776 |
| 220 | Ga0466708_323940 | 3300042652 | Bacteria | 18001 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01255 | Prenyltransf | Putative undecaprenyl diphosphate synthase | 42 | 264 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01255 | GO:0016765 | transferase activity, transferring alkyl or aryl (other than methyl) groups | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.