Protein Family IF02609
Metagenome
Isolate
266
Members
71
Samples
243
Scaffolds
229.76
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10000063|Ga0123356_1000006317
- Length
- 281 aa
- Sequence
- MTHPNKNHAADNKKENLYEISHKALFYAMTSCIASGHGVYNSCMAALYIIATPIGNLGDISFRAIETLKSADLVACEDTRRTLKLLSHFGIRVKMLSCRSQNEEYAAEKVIDALNKGQTVAYASDAGTPALSDPGAALVRAASQAGHDVIPIPGPSAFAALLSIAGGRDKTVIFEGFLSPKPGRRKSRLRELMAMEAACVLYESPFRVLKLLTDIAEIDSERYTCVGREMTKVHEEYLRGSAAEILEKLSQKKGAKTANSDVSGAQLGEFSLYISGKYLK*
Sample Types
Isolate
8.7%
Metagenome
91.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.0%
Unclassified
33.3%
Kalotermitidae
14.5%
Rhinotermitidae
4.3%
Termopsidae
4.3%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
248
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 8 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 9 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 10 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 11 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 12 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 13 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 14 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 15 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 20 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 21 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 29 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 34 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 37 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 41 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 42 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 43 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 44 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 45 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 46 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 47 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 48 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 49 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 50 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 51 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 52 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 53 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 54 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 55 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 56 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 57 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 58 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 59 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 60 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 61 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 62 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 63 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 64 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 65 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 66 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 67 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 68 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 69 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 70 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 71 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_114139 | 3300042656 | Bacteria | 11222 |
| 2 | Ga0466732_407319 | 3300042656 | Bacteria | 4861 |
| 3 | Ga0123356_10008669 | 3300010049 | Bacteria | 10089 |
| 4 | Ga0466712_010761 | 3300042614 | Bacteria | 2429 |
| 5 | Ga0466712_014215 | 3300042614 | Bacteria | 5234 |
| 6 | Ga0466712_031620 | 3300042614 | Bacteria | 32683 |
| 7 | Ga0466712_159587 | 3300042614 | Bacteria | 4956 |
| 8 | Ga0466718_087430 | 3300042617 | Bacteria | 7084 |
| 9 | Ga0466718_106108 | 3300042617 | Bacteria | 1161 |
| 10 | Ga0466726_070087 | 3300042619 | Bacteria | 4584 |
| 11 | Ga0466694_099577 | 3300042594 | Bacteria | 97987 |
| 12 | Ga0466699_138477 | 3300042597 | Bacteria | 3099 |
| 13 | Ga0466699_268427 | 3300042597 | Bacteria | 1968 |
| 14 | Ga0466707_015942 | 3300042601 | Bacteria | 1917 |
| 15 | Ga0466717_006780 | 3300042604 | Bacteria | 1361 |
| 16 | Ga0466720_047060 | 3300042607 | Bacteria | 1064 |
| 17 | Ga0466722_080694 | 3300042609 | Unclassified | 8609 |
| 18 | Ga0466731_301096 | 3300042622 | Bacteria | 1079 |
| 19 | Ga0466702_112803 | 3300042635 | Bacteria | 14797 |
| 20 | Ga0466702_212501 | 3300042635 | Bacteria | 1682 |
| 21 | Ga0466703_001837 | 3300042636 | Bacteria | 8288 |
| 22 | JGI24698J34947_10000453 | 3300002449 | Bacteria | 19048 |
| 23 | JGI24698J34947_10000874 | 3300002449 | Bacteria | 15207 |
| 24 | JGI24698J34947_10002029 | 3300002449 | Bacteria | 10795 |
| 25 | JGI24698J34947_10091714 | 3300002449 | Bacteria | 1392 |
| 26 | JGI24698J34947_10172934 | 3300002449 | Bacteria | 872 |
| 27 | JGI24695J34938_10000230 | 3300002450 | Bacteria | 53061 |
| 28 | JGI24695J34938_10003480 | 3300002450 | Bacteria | 10978 |
| 29 | JGI24695J34938_10006583 | 3300002450 | Bacteria | 6939 |
| 30 | JGI24695J34938_10031516 | 3300002450 | Bacteria | 2459 |
| 31 | JGI24695J34938_10044756 | 3300002450 | Bacteria | 1967 |
| 32 | Ga0072940_1009954 | 3300005200 | Bacteria | 4841 |
| 33 | Ga0072941_1001255 | 3300005201 | Bacteria | 90205 |
| 34 | Ga0072941_1025637 | 3300005201 | Bacteria | 10451 |
| 35 | Ga0072941_1048046 | 3300005201 | Unclassified | 8044 |
| 36 | Ga0072941_1063502 | 3300005201 | Bacteria | 3859 |
| 37 | Ga0123356_10017418 | 3300010049 | Bacteria | 6835 |
| 38 | Ga0123356_11081471 | 3300010049 | Bacteria | 971 |
| 39 | Ga0123354_10014341 | 3300010882 | Bacteria | 12341 |
| 40 | Ga0466712_001297 | 3300042614 | Bacteria | 1134 |
| 41 | Ga0466718_028419 | 3300042617 | Unclassified | 5148 |
| 42 | Ga0466718_088135 | 3300042617 | Bacteria | 1755 |
| 43 | Ga0466718_113475 | 3300042617 | Bacteria | 2178 |
| 44 | Ga0466718_134336 | 3300042617 | Bacteria | 7484 |
| 45 | Ga0415639_075904 | 3300038395 | Bacteria | 1752 |
| 46 | Ga0415639_081433 | 3300038395 | Bacteria | 1435 |
| 47 | Ga0466690_055858 | 3300042590 | Bacteria | 5006 |
| 48 | Ga0466694_132965 | 3300042594 | Bacteria | 25252 |
| 49 | Ga0466717_221891 | 3300042604 | Bacteria | 1369 |
| 50 | Ga0466720_132668 | 3300042607 | Bacteria | 1812 |
| 51 | JGI24698J34947_10004941 | 3300002449 | Bacteria | 7307 |
| 52 | JGI24698J34947_10014160 | 3300002449 | Bacteria | 4343 |
| 53 | JGI24698J34947_10045134 | 3300002449 | Bacteria | 2251 |
| 54 | JGI24698J34947_10047165 | 3300002449 | Unclassified | 2188 |
| 55 | JGI24695J34938_10000083 | 3300002450 | Bacteria | 81347 |
| 56 | JGI24699J35502_11075713 | 3300002509 | Bacteria | 1902 |
| 57 | Ga0072941_1019579 | 3300005201 | Bacteria | 1668 |
| 58 | Ga0072941_1021862 | 3300005201 | Bacteria | 6102 |
| 59 | Ga0072941_1025636 | 3300005201 | Bacteria | 1110 |
| 60 | Ga0072941_1025667 | 3300005201 | Bacteria | 3431 |
| 61 | Ga0074263_122874 | 3300005485 | Unclassified | 838 |
| 62 | Ga0466732_009069 | 3300042656 | Bacteria | 1851 |
| 63 | Ga0123353_10263619 | 3300010167 | Bacteria | 2659 |
| 64 | Ga0466712_079146 | 3300042614 | Bacteria | 1230 |
| 65 | Ga0466718_127790 | 3300042617 | Bacteria | 5392 |
| 66 | Ga0466718_133954 | 3300042617 | Bacteria | 5877 |
| 67 | Ga0466723_286074 | 3300042618 | Bacteria | 1836 |
| 68 | Ga0264413_103394 | 3300024493 | Bacteria | 29703 |
| 69 | Ga0264413_108958 | 3300024493 | Bacteria | 7074 |
| 70 | Ga0415639_007289 | 3300038395 | Bacteria | 20947 |
| 71 | Ga0415639_018077 | 3300038395 | Bacteria | 6521 |
| 72 | Ga0415639_018094 | 3300038395 | Bacteria | 3512 |
| 73 | Ga0466694_015097 | 3300042594 | Bacteria | 1029 |
| 74 | Ga0466700_474886 | 3300042600 | Bacteria | 1499 |
| 75 | Ga0466720_082240 | 3300042607 | Bacteria | 7986 |
| 76 | Ga0466720_128379 | 3300042607 | Unclassified | 1904 |
| 77 | Ga0466720_238804 | 3300042607 | Bacteria | 10855 |
| 78 | Ga0466722_171300 | 3300042609 | Bacteria | 2127 |
| 79 | Ga0466698_127505 | 3300042610 | Bacteria | 18075 |
| 80 | Ga0466704_254821 | 3300042643 | Bacteria | 2782 |
| 81 | Ga0466704_288413 | 3300042643 | Bacteria | 2515 |
| 82 | Ga0466704_394620 | 3300042643 | Bacteria | 6775 |
| 83 | Nasutiter_Contig42648 | 2030936001 | Bacteria | 1476 |
| 84 | AustNasuHG_c1001823 | 3300000089 | Bacteria | 7709 |
| 85 | JGI24698J34947_10040426 | 3300002449 | Bacteria | 2408 |
| 86 | JGI24698J34947_10044393 | 3300002449 | Unclassified | 2275 |
| 87 | JGI24695J34938_10002385 | 3300002450 | Bacteria | 14433 |
| 88 | JGI24702J35022_10008267 | 3300002462 | Bacteria | 5899 |
| 89 | JGI24699J35502_11132492 | 3300002509 | Bacteria | 6971 |
| 90 | Ga0072941_1025638 | 3300005201 | Bacteria | 6163 |
| 91 | Ga0123355_10037980 | 3300009826 | Bacteria | 7830 |
| 92 | Ga0123356_10027416 | 3300010049 | Unclassified | 5338 |
| 93 | Ga0123356_10055574 | 3300010049 | Bacteria | 3688 |
| 94 | Ga0123356_10171970 | 3300010049 | Bacteria | 2178 |
| 95 | Ga0123353_10609336 | 3300010167 | Bacteria | 1558 |
| 96 | Ga0466712_007013 | 3300042614 | Bacteria | 2703 |
| 97 | Ga0466715_084371 | 3300042616 | Bacteria | 11174 |
| 98 | Ga0466715_518145 | 3300042616 | Bacteria | 1277 |
| 99 | Ga0466718_122724 | 3300042617 | Bacteria | 29201 |
| 100 | Ga0466718_159868 | 3300042617 | Bacteria | 6271 |
| 101 | Ga0466726_023712 | 3300042619 | Bacteria | 3378 |
| 102 | Ga0466726_073543 | 3300042619 | Bacteria | 2105 |
| 103 | Ga0466692_111987 | 3300042591 | Bacteria | 4107 |
| 104 | Ga0466694_179357 | 3300042594 | Bacteria | 10022 |
| 105 | Ga0466694_290074 | 3300042594 | Bacteria | 3138 |
| 106 | Ga0466699_228001 | 3300042597 | Bacteria | 2124 |
| 107 | Ga0466719_082430 | 3300042606 | Bacteria | 1342 |
| 108 | Ga0466720_118600 | 3300042607 | Bacteria | 7514 |
| 109 | Ga0466720_157244 | 3300042607 | Bacteria | 34467 |
| 110 | Ga0466721_336121 | 3300042608 | Bacteria | 2068 |
| 111 | JGI24698J34947_10006508 | 3300002449 | Bacteria | 6410 |
| 112 | JGI24698J34947_10029132 | 3300002449 | Bacteria | 2919 |
| 113 | JGI24695J34938_10000339 | 3300002450 | Bacteria | 46161 |
| 114 | JGI24695J34938_10002098 | 3300002450 | Bacteria | 15622 |
| 115 | Ga0072941_1071261 | 3300005201 | Bacteria | 2355 |
| 116 | Ga0072941_1123611 | 3300005201 | Bacteria | 970 |
| 117 | Ga0466732_055585 | 3300042656 | Bacteria | 4931 |
| 118 | Ga0123356_10000034 | 3300010049 | Bacteria | 149865 |
| 119 | Ga0123356_10100182 | 3300010049 | Bacteria | 2778 |
| 120 | Ga0466712_048639 | 3300042614 | Bacteria | 6339 |
| 121 | Ga0466712_253237 | 3300042614 | Bacteria | 1558 |
| 122 | Ga0466718_080755 | 3300042617 | Bacteria | 2333 |
| 123 | Ga0466718_086242 | 3300042617 | Bacteria | 67871 |
| 124 | Ga0466718_123646 | 3300042617 | Bacteria | 25776 |
| 125 | Ga0466692_173902 | 3300042591 | Bacteria | 15167 |
| 126 | Ga0466694_131129 | 3300042594 | Bacteria | 1585 |
| 127 | Ga0466694_146969 | 3300042594 | Bacteria | 18139 |
| 128 | Ga0466694_240754 | 3300042594 | Bacteria | 8618 |
| 129 | Ga0466699_399799 | 3300042597 | Bacteria | 6929 |
| 130 | Ga0466720_042620 | 3300042607 | Bacteria | 5406 |
| 131 | Ga0466722_098751 | 3300042609 | Bacteria | 2885 |
| 132 | Ga0466704_399400 | 3300042643 | Bacteria | 5854 |
| 133 | JGI24698J34947_10018023 | 3300002449 | Unclassified | 3821 |
| 134 | JGI24698J34947_10023021 | 3300002449 | Bacteria | 3334 |
| 135 | JGI24698J34947_10031718 | 3300002449 | Bacteria | 2779 |
| 136 | JGI24700J35501_10930915 | 3300002508 | Bacteria | 43325 |
| 137 | Ga0072941_1004782 | 3300005201 | Bacteria | 9658 |
| 138 | Ga0466732_078800 | 3300042656 | Bacteria | 5498 |
| 139 | Ga0123356_10002470 | 3300010049 | Bacteria | 19739 |
| 140 | Ga0123356_10003845 | 3300010049 | Bacteria | 15640 |
| 141 | Ga0123356_10117358 | 3300010049 | Bacteria | 2582 |
| 142 | Ga0123353_10004113 | 3300010167 | Bacteria | 18644 |
| 143 | Ga0466712_000311 | 3300042614 | Bacteria | 11200 |
| 144 | Ga0466712_011551 | 3300042614 | Unclassified | 6662 |
| 145 | Ga0466711_066401 | 3300042615 | Bacteria | 3286 |
| 146 | Ga0466711_312387 | 3300042615 | Bacteria | 16329 |
| 147 | Ga0466715_099050 | 3300042616 | Bacteria | 12218 |
| 148 | Ga0466718_047925 | 3300042617 | Bacteria | 8329 |
| 149 | Ga0466718_051261 | 3300042617 | Bacteria | 1413 |
| 150 | Ga0466718_053338 | 3300042617 | Bacteria | 2983 |
| 151 | Ga0466718_120285 | 3300042617 | Bacteria | 5060 |
| 152 | Ga0466718_150146 | 3300042617 | Bacteria | 1522 |
| 153 | Ga0466723_014100 | 3300042618 | Bacteria | 7996 |
| 154 | Ga0466726_208239 | 3300042619 | Bacteria | 4852 |
| 155 | Ga0466692_192106 | 3300042591 | Bacteria | 2947 |
| 156 | Ga0466692_202029 | 3300042591 | Bacteria | 1452 |
| 157 | Ga0466693_271148 | 3300042592 | Bacteria | 1145 |
| 158 | Ga0466693_381167 | 3300042592 | Bacteria | 1596 |
| 159 | Ga0466699_220689 | 3300042597 | Bacteria | 48448 |
| 160 | Ga0466706_251884 | 3300042599 | Bacteria | 23959 |
| 161 | Ga0466720_020360 | 3300042607 | Bacteria | 4487 |
| 162 | Ga0466720_086014 | 3300042607 | Bacteria | 1437 |
| 163 | Ga0466720_192025 | 3300042607 | Unclassified | 4338 |
| 164 | Ga0466722_038326 | 3300042609 | Bacteria | 14213 |
| 165 | Ga0466702_182634 | 3300042635 | Bacteria | 5860 |
| 166 | Ga0466708_077089 | 3300042652 | Bacteria | 7872 |
| 167 | Ga0466727_050290 | 3300042655 | Bacteria | 2764 |
| 168 | Ga0466727_193187 | 3300042655 | Bacteria | 3564 |
| 169 | JGI24698J34947_10000369 | 3300002449 | Bacteria | 20214 |
| 170 | JGI24695J34938_10000647 | 3300002450 | Bacteria | 33260 |
| 171 | JGI24695J34938_10003183 | 3300002450 | Bacteria | 11654 |
| 172 | JGI24695J34938_10005516 | 3300002450 | Bacteria | 7860 |
| 173 | JGI24695J34938_10010214 | 3300002450 | Bacteria | 5165 |
| 174 | Ga0072941_1010382 | 3300005201 | Bacteria | 3265 |
| 175 | Ga0072941_1054126 | 3300005201 | Bacteria | 4100 |
| 176 | Ga0072941_1058336 | 3300005201 | Bacteria | 3577 |
| 177 | Ga0123356_10033896 | 3300010049 | Bacteria | 4776 |
| 178 | Ga0466712_059489 | 3300042614 | Bacteria | 8199 |
| 179 | Ga0466712_076547 | 3300042614 | Bacteria | 15018 |
| 180 | Ga0466712_124354 | 3300042614 | Bacteria | 1323 |
| 181 | Ga0466712_217593 | 3300042614 | Bacteria | 3877 |
| 182 | Ga0466711_356969 | 3300042615 | Bacteria | 31563 |
| 183 | Ga0466718_156226 | 3300042617 | Bacteria | 16250 |
| 184 | Ga0264413_113632 | 3300024493 | Bacteria | 6159 |
| 185 | Ga0415639_084419 | 3300038395 | Bacteria | 2029 |
| 186 | Ga0466692_100747 | 3300042591 | Bacteria | 1240 |
| 187 | Ga0466693_297709 | 3300042592 | Bacteria | 5575 |
| 188 | Ga0466691_058900 | 3300042593 | Bacteria | 12683 |
| 189 | Ga0466694_240902 | 3300042594 | Unclassified | 9935 |
| 190 | Ga0466695_330656 | 3300042595 | Bacteria | 23944 |
| 191 | Ga0466700_423601 | 3300042600 | Bacteria | 6987 |
| 192 | Ga0466719_152491 | 3300042606 | Bacteria | 6653 |
| 193 | Ga0466720_060753 | 3300042607 | Bacteria | 13317 |
| 194 | Ga0466720_090464 | 3300042607 | Bacteria | 2685 |
| 195 | Ga0466722_041005 | 3300042609 | Bacteria | 32391 |
| 196 | Ga0466731_283959 | 3300042622 | Bacteria | 2447 |
| 197 | Ga0466735_101647 | 3300042624 | Bacteria | 9240 |
| 198 | Ga0466702_340616 | 3300042635 | Bacteria | 1959 |
| 199 | Ga0466709_066692 | 3300042648 | Bacteria | 4511 |
| 200 | Ga0466709_114717 | 3300042648 | Bacteria | 11852 |
| 201 | AustNasuHG_c1013578 | 3300000089 | Bacteria | 2790 |
| 202 | JGI24698J34947_10010657 | 3300002449 | Unclassified | 5047 |
| 203 | JGI24698J34947_10019994 | 3300002449 | Unclassified | 3609 |
| 204 | JGI24698J34947_10020807 | 3300002449 | Unclassified | 3532 |
| 205 | JGI24698J34947_10053827 | 3300002449 | Bacteria | 2012 |
| 206 | JGI24698J34947_10089572 | 3300002449 | Unclassified | 1416 |
| 207 | JGI24695J34938_10000092 | 3300002450 | Bacteria | 78528 |
| 208 | JGI24695J34938_10001422 | 3300002450 | Bacteria | 20378 |
| 209 | JGI24695J34938_10004774 | 3300002450 | Bacteria | 8733 |
| 210 | JGI24695J34938_10016951 | 3300002450 | Bacteria | 3687 |
| 211 | Ga0072941_1001843 | 3300005201 | Bacteria | 32220 |
| 212 | Ga0123357_10076370 | 3300009784 | Bacteria | 4424 |
| 213 | Ga0123356_10000063 | 3300010049 | Bacteria | 111723 |
| 214 | Ga0123356_10007749 | 3300010049 | Bacteria | 10693 |
| 215 | Ga0123356_10128024 | 3300010049 | Bacteria | 2483 |
| 216 | Ga0123356_10182289 | 3300010049 | Bacteria | 2123 |
| 217 | Ga0123356_10192816 | 3300010049 | Bacteria | 2070 |
| 218 | Ga0466712_028099 | 3300042614 | Bacteria | 19926 |
| 219 | Ga0466712_219420 | 3300042614 | Bacteria | 1349 |
| 220 | Ga0466712_270040 | 3300042614 | Bacteria | 6672 |
| 221 | Ga0466715_584290 | 3300042616 | Bacteria | 44080 |
| 222 | Ga0466718_005582 | 3300042617 | Unclassified | 2732 |
| 223 | Ga0466718_010338 | 3300042617 | Bacteria | 3202 |
| 224 | Ga0466718_047359 | 3300042617 | Bacteria | 1463 |
| 225 | Ga0466718_156437 | 3300042617 | Bacteria | 7843 |
| 226 | Ga0264413_105391 | 3300024493 | Bacteria | 18355 |
| 227 | Ga0456237_0001567 | 3300041968 | Bacteria | 3651 |
| 228 | Ga0466692_005898 | 3300042591 | Bacteria | 13737 |
| 229 | Ga0466693_021526 | 3300042592 | Bacteria | 40073 |
| 230 | Ga0466699_069750 | 3300042597 | Bacteria | 2799 |
| 231 | Ga0466699_214166 | 3300042597 | Bacteria | 1251 |
| 232 | Ga0466700_209387 | 3300042600 | Bacteria | 1095 |
| 233 | Ga0466720_171378 | 3300042607 | Bacteria | 4367 |
| 234 | Ga0466722_105680 | 3300042609 | Bacteria | 3988 |
| 235 | Ga0466735_023146 | 3300042624 | Bacteria | 10947 |
| 236 | JGI24698J34947_10009079 | 3300002449 | Bacteria | 5455 |
| 237 | JGI24698J34947_10049195 | 3300002449 | Unclassified | 2131 |
| 238 | JGI24695J34938_10000734 | 3300002450 | Bacteria | 30892 |
| 239 | JGI24695J34938_10267942 | 3300002450 | Bacteria | 729 |
| 240 | JGI24702J35022_10118012 | 3300002462 | Bacteria | 1464 |
| 241 | Ga0072941_1025600 | 3300005201 | Bacteria | 4021 |
| 242 | Ga0072941_1045466 | 3300005201 | Bacteria | 2065 |
| 243 | Ga0072941_1075225 | 3300005201 | Bacteria | 8777 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00590 | TP_methylase | Tetrapyrrole (Corrin/Porphyrin) Methylases | 47 | 245 | 0.89 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00590 | GO:0008168 | methyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.