Protein Family IF02597
Metagenome
Metatranscriptome
Isolate
173
Members
64
Samples
158
Scaffolds
160.67
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_11125455|Ga0123355_111254551
- Length
- 188 aa
- Sequence
- MLPLKKALAKINKGVYTKITRRCGQMRRQKIYLDTSVISHLDAPDALEKQQDTRKLWDIIKAGTFEVFISPVVVGELMNCAEPKRSGLLEQLAVIDHTELKESDEVLELATQYLDAGILRKKSFDDCQHIAYACVYNCDMLVSWNFKHMVNIKTISGVKGVNALAGYKEMPIYTPTILISGGADDDI*
Sample Types
Isolate
8.7%
Metagenome
90.8%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
51.6%
Unclassified
25.8%
Kalotermitidae
11.3%
Termopsidae
4.8%
Passalidae
3.2%
Hodotermitidae
1.6%
Rhinotermitidae
1.6%
Taxonomy
Archaea
3
Bacteria
139
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 2 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 3 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 4 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 5 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 6 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 24 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 30 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 31 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 33 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 35 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 36 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 37 | 2820450073 | Unclassified Firmicutes Lab288P3bin186 | Isolate | Unclassified |
| 38 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 39 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 40 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 42 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 43 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 46 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 47 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 48 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 51 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 52 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 55 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 56 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 57 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 58 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 61 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 62 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 63 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 64 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466710_163770 | 3300042613 | Bacteria | 1194 |
| 2 | Ga0123355_10894292 | 3300009826 | Bacteria | 966 |
| 3 | Ga0123356_11068151 | 3300010049 | Bacteria | 976 |
| 4 | Ga0123356_11525885 | 3300010049 | Bacteria | 825 |
| 5 | Ga0123353_12130850 | 3300010167 | Bacteria | 681 |
| 6 | Ga0123354_10004718 | 3300010882 | Bacteria | 19441 |
| 7 | Ga0415639_014610 | 3300038395 | Bacteria | 29091 |
| 8 | Ga0415639_050167 | 3300038395 | Bacteria | 3508 |
| 9 | Ga0415639_073849 | 3300038395 | Unclassified | 1681 |
| 10 | Ga0415639_147560 | 3300038395 | Bacteria | 1631 |
| 11 | Ga0466690_009692 | 3300042590 | Bacteria | 1208 |
| 12 | Ga0466694_056020 | 3300042594 | Unclassified | 1193 |
| 13 | Ga0466694_180828 | 3300042594 | Bacteria | 5603 |
| 14 | Ga0466694_389148 | 3300042594 | Bacteria | 1399 |
| 15 | IMNBL1DRAFT_c0000569 | 3300000062 | Unclassified | 29851 |
| 16 | IMNBL1DRAFT_c0014057 | 3300000062 | Bacteria | 3556 |
| 17 | IMNBL1DRAFT_c0021038 | 3300000062 | Bacteria | 2622 |
| 18 | JGI24695J34938_10037371 | 3300002450 | Bacteria | 2207 |
| 19 | JGI24702J35022_10005160 | 3300002462 | Bacteria | 7662 |
| 20 | JGI24702J35022_10149700 | 3300002462 | Bacteria | 1309 |
| 21 | JGI24696J40584_12933510 | 3300002834 | Bacteria | 1522 |
| 22 | Ga0068302_10228046 | 3300005071 | Unclassified | 1408 |
| 23 | Ga0466703_185650 | 3300042636 | Bacteria | 1482 |
| 24 | Ga0466706_084772 | 3300042599 | Bacteria | 36812 |
| 25 | Ga0466706_141387 | 3300042599 | Unclassified | 1126 |
| 26 | Ga0466714_047041 | 3300042603 | Bacteria | 3589 |
| 27 | Ga0466705_023605 | 3300042612 | Bacteria | 2071 |
| 28 | Ga0466732_026992 | 3300042656 | Bacteria | 1394 |
| 29 | Ga0466733_092160 | 3300042659 | Bacteria | 10268 |
| 30 | Ga0466712_297101 | 3300042614 | Bacteria | 2280 |
| 31 | Ga0466726_009346 | 3300042619 | Bacteria | 1543 |
| 32 | Ga0466726_064409 | 3300042619 | Bacteria | 2356 |
| 33 | Ga0123357_10004368 | 3300009784 | Bacteria | 16571 |
| 34 | Ga0123357_10724219 | 3300009784 | Bacteria | 703 |
| 35 | Ga0123355_11125455 | 3300009826 | Bacteria | 813 |
| 36 | Ga0123356_10003447 | 3300010049 | Bacteria | 16558 |
| 37 | Ga0123356_10213822 | 3300010049 | Bacteria | 1979 |
| 38 | Ga0123356_10460428 | 3300010049 | Bacteria | 1421 |
| 39 | Ga0123356_11140957 | 3300010049 | Bacteria | 947 |
| 40 | Ga0123356_11378835 | 3300010049 | Bacteria | 866 |
| 41 | Ga0415639_002193 | 3300038395 | Bacteria | 25297 |
| 42 | Ga0466693_155191 | 3300042592 | Bacteria | 1951 |
| 43 | 2227479965 | 2225789004 | Bacteria | 856 |
| 44 | JGI24695J34938_10068036 | 3300002450 | Bacteria | 1497 |
| 45 | JGI24700J35501_10917964 | 3300002508 | Unclassified | 4213 |
| 46 | JGI24696J40584_12955460 | 3300002834 | Bacteria | 2840 |
| 47 | Ga0072940_1157918 | 3300005200 | Bacteria | 2317 |
| 48 | Ga0466706_129033 | 3300042599 | Bacteria | 2151 |
| 49 | Ga0466706_159738 | 3300042599 | Bacteria | 1129 |
| 50 | Ga0466706_177826 | 3300042599 | Bacteria | 1568 |
| 51 | Ga0466700_027858 | 3300042600 | Unclassified | 1347 |
| 52 | Ga0466714_021664 | 3300042603 | Bacteria | 2544 |
| 53 | Ga0466698_069241 | 3300042610 | Bacteria | 13138 |
| 54 | Ga0466711_182388 | 3300042615 | Bacteria | 1077 |
| 55 | Ga0466729_108987 | 3300042621 | Bacteria | 1036 |
| 56 | Ga0123355_10179318 | 3300009826 | Archaea | 3147 |
| 57 | Ga0123355_10589226 | 3300009826 | Unclassified | 1325 |
| 58 | Ga0123356_10822848 | 3300010049 | Unclassified | 1100 |
| 59 | Ga0123353_11554722 | 3300010167 | Unclassified | 839 |
| 60 | Ga0123354_10081411 | 3300010882 | Unclassified | 4574 |
| 61 | Ga0223674_1015512 | 3300021235 | Bacteria | 929 |
| 62 | Ga0466693_360525 | 3300042592 | Unclassified | 1225 |
| 63 | JGI24696J40584_12951973 | 3300002834 | Bacteria | 2295 |
| 64 | Ga0072941_1067412 | 3300005201 | Bacteria | 2272 |
| 65 | Ga0466725_146700 | 3300042654 | Bacteria | 1119 |
| 66 | Ga0466706_220490 | 3300042599 | Bacteria | 222739 |
| 67 | Ga0466711_094079 | 3300042615 | Bacteria | 2416 |
| 68 | Ga0123355_10000179 | 3300009826 | Bacteria | 78580 |
| 69 | Ga0123355_10945215 | 3300009826 | Bacteria | 927 |
| 70 | Ga0123355_10953653 | 3300009826 | Unclassified | 920 |
| 71 | Ga0123356_12782095 | 3300010049 | Bacteria | 612 |
| 72 | Ga0123353_11922426 | 3300010167 | Bacteria | 729 |
| 73 | Ga0415639_048419 | 3300038395 | Bacteria | 5122 |
| 74 | Ga0415639_181751 | 3300038395 | Bacteria | 1177 |
| 75 | Ga0466656_355260 | 3300042550 | Unclassified | 1897 |
| 76 | Ga0466693_082643 | 3300042592 | Bacteria | 2664 |
| 77 | Ga0072940_1045999 | 3300005200 | Bacteria | 21348 |
| 78 | Ga0072941_1002870 | 3300005201 | Bacteria | 5956 |
| 79 | Ga0072941_1158637 | 3300005201 | Unclassified | 3746 |
| 80 | Ga0072941_1558481 | 3300005201 | Bacteria | 694 |
| 81 | Ga0466700_307876 | 3300042600 | Unclassified | 4574 |
| 82 | Ga0466718_018572 | 3300042617 | Bacteria | 1690 |
| 83 | Ga0123355_10734563 | 3300009826 | Bacteria | 1122 |
| 84 | Ga0123355_11003350 | 3300009826 | Bacteria | 886 |
| 85 | Ga0123353_10018818 | 3300010167 | Bacteria | 10233 |
| 86 | Ga0123353_10366031 | 3300010167 | Bacteria | 2164 |
| 87 | Ga0123353_11913322 | 3300010167 | Bacteria | 731 |
| 88 | Ga0123354_10095835 | 3300010882 | Archaea | 4058 |
| 89 | Ga0123354_10436815 | 3300010882 | Bacteria | 1073 |
| 90 | Ga0466657_278548 | 3300042582 | Bacteria | 2472 |
| 91 | Ga0466693_058865 | 3300042592 | Bacteria | 1358 |
| 92 | JGI24702J35022_10606679 | 3300002462 | Bacteria | 677 |
| 93 | Ga0068305_10158701 | 3300005083 | Bacteria | 1561 |
| 94 | Ga0072941_1081905 | 3300005201 | Bacteria | 626 |
| 95 | Ga0072941_1366275 | 3300005201 | Bacteria | 997 |
| 96 | Ga0466703_254851 | 3300042636 | Bacteria | 5583 |
| 97 | Ga0466709_179531 | 3300042648 | Bacteria | 1380 |
| 98 | Ga0466706_152900 | 3300042599 | Unclassified | 1063 |
| 99 | Ga0466700_141715 | 3300042600 | Bacteria | 1198 |
| 100 | Ga0466714_050522 | 3300042603 | Bacteria | 4304 |
| 101 | Ga0466717_293743 | 3300042604 | Bacteria | 3398 |
| 102 | Ga0466733_214352 | 3300042659 | Bacteria | 1200 |
| 103 | Ga0466718_053311 | 3300042617 | Bacteria | 1337 |
| 104 | Ga0123355_10001387 | 3300009826 | Bacteria | 33783 |
| 105 | Ga0123355_10006747 | 3300009826 | Unclassified | 17087 |
| 106 | Ga0123355_10008805 | 3300009826 | Bacteria | 15269 |
| 107 | Ga0123355_10137333 | 3300009826 | Bacteria | 3752 |
| 108 | Ga0123355_10343453 | 3300009826 | Unclassified | 1986 |
| 109 | Ga0123355_11172589 | 3300009826 | Bacteria | 788 |
| 110 | Ga0123353_10762892 | 3300010167 | Bacteria | 1344 |
| 111 | Ga0123353_10800631 | 3300010167 | Bacteria | 1301 |
| 112 | Ga0123354_10000047 | 3300010882 | Bacteria | 92241 |
| 113 | Ga0415639_009793 | 3300038395 | Unclassified | 14046 |
| 114 | Ga0466691_119387 | 3300042593 | Bacteria | 4006 |
| 115 | JGI24702J35022_10072041 | 3300002462 | Bacteria | 1862 |
| 116 | JGI24696J40584_12741261 | 3300002834 | Unclassified | 782 |
| 117 | Ga0466725_147630 | 3300042654 | Unclassified | 1337 |
| 118 | Ga0466701_041984 | 3300042598 | Unclassified | 1055 |
| 119 | Ga0466706_055676 | 3300042599 | Bacteria | 1335 |
| 120 | Ga0466700_269671 | 3300042600 | Archaea | 1347 |
| 121 | Ga0466714_035255 | 3300042603 | Bacteria | 7635 |
| 122 | Ga0466720_021220 | 3300042607 | Bacteria | 2313 |
| 123 | Ga0466697_249987 | 3300042611 | Bacteria | 2129 |
| 124 | Ga0466705_367871 | 3300042612 | Bacteria | 1023 |
| 125 | Ga0466733_016949 | 3300042659 | Bacteria | 2424 |
| 126 | Ga0466711_165746 | 3300042615 | Unclassified | 1094 |
| 127 | Ga0466711_220785 | 3300042615 | Bacteria | 2514 |
| 128 | Ga0466726_453494 | 3300042619 | Bacteria | 11721 |
| 129 | Ga0123355_10001032 | 3300009826 | Bacteria | 38573 |
| 130 | Ga0123355_10028079 | 3300009826 | Bacteria | 9095 |
| 131 | Ga0123356_10899251 | 3300010049 | Bacteria | 1057 |
| 132 | Ga0123353_10000942 | 3300010167 | Bacteria | 35531 |
| 133 | Ga0123353_10516790 | 3300010167 | Bacteria | 1734 |
| 134 | Ga0123353_11441345 | 3300010167 | Bacteria | 882 |
| 135 | Ga0466657_257666 | 3300042582 | Bacteria | 1012 |
| 136 | Ga0466693_073937 | 3300042592 | Unclassified | 1550 |
| 137 | Ga0466699_126163 | 3300042597 | Bacteria | 1013 |
| 138 | JGI24696J40584_12961227 | 3300002834 | Bacteria | 12367 |
| 139 | Ga0072941_1002425 | 3300005201 | Unclassified | 927 |
| 140 | Ga0072941_1566850 | 3300005201 | Bacteria | 2271 |
| 141 | Ga0466731_392639 | 3300042622 | Bacteria | 1312 |
| 142 | Ga0466706_253628 | 3300042599 | Unclassified | 2104 |
| 143 | Ga0466714_100743 | 3300042603 | Bacteria | 2115 |
| 144 | Ga0466720_218951 | 3300042607 | Unclassified | 1336 |
| 145 | Ga0123355_10223027 | 3300009826 | Bacteria | 2707 |
| 146 | Ga0123355_10476174 | 3300009826 | Bacteria | 1556 |
| 147 | Ga0123353_10039073 | 3300010167 | Bacteria | 7465 |
| 148 | Ga0123353_11290182 | 3300010167 | Bacteria | 949 |
| 149 | Ga0123353_12191941 | 3300010167 | Bacteria | 669 |
| 150 | Ga0415639_081171 | 3300038395 | Bacteria | 7787 |
| 151 | JGI24705J35276_12134586 | 3300002504 | Unclassified | 1117 |
| 152 | Ga0072941_1019996 | 3300005201 | Bacteria | 6065 |
| 153 | Ga0072941_1577200 | 3300005201 | Bacteria | 525 |
| 154 | Ga0466735_124843 | 3300042624 | Bacteria | 2587 |
| 155 | Ga0466702_132239 | 3300042635 | Bacteria | 2010 |
| 156 | Ga0466706_247446 | 3300042599 | Unclassified | 1354 |
| 157 | Ga0466719_109861 | 3300042606 | Bacteria | 13806 |
| 158 | Ga0466698_451275 | 3300042610 | Unclassified | 1763 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.