Protein Family IF02578
Metagenome
Isolate
177
Members
50
Samples
156
Scaffolds
124.11
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10716573|Ga0123355_107165732
- Length
- 136 aa
- Sequence
- MMLRSDMIRDIHSTPRNSILNDIPADNIYIACGYTDMRRQVDGLAAMVQQVFGQNPSARNLYLFCGRRSDRIKALYYEGDGYLLLYKRLERARFQWPRKESEARMITPQQLRWLLEGLSIEQPKAIKATAPVFVV*
Sample Types
Isolate
11.9%
Metagenome
88.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
62.5%
Blattidae
14.6%
Unclassified
8.3%
Tenebrionidae
4.2%
Hodotermitidae
2.1%
Kalotermitidae
2.1%
Termopsidae
2.1%
Passalidae
2.1%
Hydrophilidae
2.1%
Taxonomy
Archaea
0
Bacteria
152
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 2 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 13 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 14 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 15 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300005283 | Nasutitermes corniger P1 gut segment microbial communitites from University of Florida, USA - Alkaline Insect Gut Metagenome: eDNA_1 | Metagenome | Termitidae |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 26 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 27 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 30 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 31 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 32 | 2820058318 | Unclassified Proteobacteria Nt197P4bin33 | Isolate | Unclassified |
| 33 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 34 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 40 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 43 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 44 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 45 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 46 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 47 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 48 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 49 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 50 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_123596 | 3300042611 | Bacteria | 3731 |
| 2 | Ga0466710_444314 | 3300042613 | Bacteria | 1137 |
| 3 | Ga0466693_062266 | 3300042592 | Bacteria | 2552 |
| 4 | Ga0466693_417504 | 3300042592 | Bacteria | 1294 |
| 5 | Ga0466721_328726 | 3300042608 | Bacteria | 1435 |
| 6 | Ga0466697_046103 | 3300042611 | Bacteria | 2751 |
| 7 | Ga0466735_189564 | 3300042624 | Bacteria | 2297 |
| 8 | Ga0466725_429587 | 3300042654 | Bacteria | 3880 |
| 9 | Ga0123357_10149550 | 3300009784 | Bacteria | 2839 |
| 10 | Ga0123356_10253656 | 3300010049 | Unclassified | 1838 |
| 11 | Ga0123353_10291849 | 3300010167 | Unclassified | 2496 |
| 12 | Ga0123353_12838448 | 3300010167 | Bacteria | 566 |
| 13 | Ga0123353_12924380 | 3300010167 | Bacteria | 556 |
| 14 | JGI24698J34947_10114436 | 3300002449 | Bacteria | 1183 |
| 15 | JGI24705J35276_12225472 | 3300002504 | Bacteria | 2726 |
| 16 | Ga0068305_10002282 | 3300005083 | Unclassified | 2643 |
| 17 | Ga0068305_10211975 | 3300005083 | Bacteria | 601 |
| 18 | Ga0466697_080157 | 3300042611 | Bacteria | 2444 |
| 19 | Ga0466718_140194 | 3300042617 | Bacteria | 4222 |
| 20 | Ga0265387_1121408 | 3300024582 | Bacteria | 565 |
| 21 | Ga0466700_163682 | 3300042600 | Bacteria | 1597 |
| 22 | Ga0466731_019354 | 3300042622 | Unclassified | 1129 |
| 23 | Ga0466731_044859 | 3300042622 | Bacteria | 2351 |
| 24 | Ga0466731_208335 | 3300042622 | Bacteria | 4292 |
| 25 | Ga0466702_411990 | 3300042635 | Bacteria | 1275 |
| 26 | Ga0123357_10196396 | 3300009784 | Bacteria | 2310 |
| 27 | Ga0123356_10315921 | 3300010049 | Bacteria | 1673 |
| 28 | Ga0123356_11060488 | 3300010049 | Bacteria | 979 |
| 29 | Ga0123353_10243003 | 3300010167 | Bacteria | 2795 |
| 30 | Ga0123353_10568672 | 3300010167 | Unclassified | 1630 |
| 31 | JGI24702J35022_10024533 | 3300002462 | Bacteria | 3257 |
| 32 | JGI24705J35276_12225613 | 3300002504 | Unclassified | 2744 |
| 33 | Ga0415639_141317 | 3300038395 | Unclassified | 1310 |
| 34 | Ga0466693_009559 | 3300042592 | Bacteria | 1536 |
| 35 | Ga0466693_301197 | 3300042592 | Bacteria | 1759 |
| 36 | Ga0466717_205238 | 3300042604 | Bacteria | 2604 |
| 37 | Ga0466717_267483 | 3300042604 | Bacteria | 1178 |
| 38 | Ga0466721_044157 | 3300042608 | Bacteria | 1108 |
| 39 | Ga0466731_297849 | 3300042622 | Bacteria | 1034 |
| 40 | Ga0123357_10344182 | 3300009784 | Bacteria | 1437 |
| 41 | Ga0123356_10054458 | 3300010049 | Unclassified | 3726 |
| 42 | Ga0123356_10277149 | 3300010049 | Bacteria | 1770 |
| 43 | Ga0123356_11071661 | 3300010049 | Bacteria | 975 |
| 44 | Ga0123353_10997939 | 3300010167 | Unclassified | 1125 |
| 45 | Ga0123354_10434536 | 3300010882 | Bacteria | 1078 |
| 46 | JGI24702J35022_10015371 | 3300002462 | Bacteria | 4213 |
| 47 | JGI24705J35276_12193832 | 3300002504 | Bacteria | 1504 |
| 48 | JGI24705J35276_12227863 | 3300002504 | Bacteria | 3078 |
| 49 | Ga0072940_1172820 | 3300005200 | Bacteria | 1506 |
| 50 | Ga0072941_1127000 | 3300005201 | Bacteria | 3138 |
| 51 | Ga0072941_1233573 | 3300005201 | Bacteria | 3167 |
| 52 | Ga0415639_036570 | 3300038395 | Bacteria | 1272 |
| 53 | Ga0415639_122142 | 3300038395 | Bacteria | 2970 |
| 54 | Ga0466657_309142 | 3300042582 | Bacteria | 3135 |
| 55 | Ga0466693_047728 | 3300042592 | Bacteria | 1175 |
| 56 | Ga0466693_323781 | 3300042592 | Bacteria | 2793 |
| 57 | Ga0466693_340515 | 3300042592 | Bacteria | 12054 |
| 58 | Ga0466713_155249 | 3300042602 | Bacteria | 55783 |
| 59 | Ga0466721_009619 | 3300042608 | Bacteria | 1346 |
| 60 | Ga0466698_146649 | 3300042610 | Bacteria | 3343 |
| 61 | Ga0123357_10115705 | 3300009784 | Bacteria | 3399 |
| 62 | Ga0123357_10303900 | 3300009784 | Bacteria | 1606 |
| 63 | Ga0123357_10959091 | 3300009784 | Bacteria | 540 |
| 64 | Ga0123356_10060848 | 3300010049 | Bacteria | 3525 |
| 65 | Ga0123356_10098549 | 3300010049 | Bacteria | 2799 |
| 66 | Ga0123356_10321205 | 3300010049 | Bacteria | 1661 |
| 67 | Ga0123353_10178577 | 3300010167 | Bacteria | 3363 |
| 68 | Ga0123353_10279214 | 3300010167 | Bacteria | 2567 |
| 69 | Ga0123353_10729475 | 3300010167 | Bacteria | 1384 |
| 70 | Ga0123353_10733236 | 3300010167 | Bacteria | 1379 |
| 71 | Ga0123353_10846124 | 3300010167 | Bacteria | 1255 |
| 72 | Ga0123354_10084195 | 3300010882 | Bacteria | 4468 |
| 73 | Ga0065725_10000040 | 3300005283 | Bacteria | 2480 |
| 74 | Ga0466733_139199 | 3300042659 | Bacteria | 1884 |
| 75 | Ga0466718_037784 | 3300042617 | Bacteria | 4074 |
| 76 | Ga0415639_243509 | 3300038395 | Bacteria | 2141 |
| 77 | Ga0415639_292938 | 3300038395 | Unclassified | 1136 |
| 78 | Ga0466657_192166 | 3300042582 | Bacteria | 2860 |
| 79 | Ga0466693_024392 | 3300042592 | Bacteria | 2040 |
| 80 | Ga0466694_166972 | 3300042594 | Bacteria | 3796 |
| 81 | Ga0466696_484856 | 3300042596 | Bacteria | 3408 |
| 82 | Ga0466701_017781 | 3300042598 | Bacteria | 3407 |
| 83 | Ga0466701_026539 | 3300042598 | Bacteria | 2337 |
| 84 | Ga0466714_066348 | 3300042603 | Bacteria | 2948 |
| 85 | Ga0466717_128112 | 3300042604 | Unclassified | 3651 |
| 86 | Ga0466721_119251 | 3300042608 | Bacteria | 1238 |
| 87 | Ga0123357_10158226 | 3300009784 | Bacteria | 2725 |
| 88 | Ga0123356_11415475 | 3300010049 | Bacteria | 855 |
| 89 | Ga0123353_10160912 | 3300010167 | Bacteria | 3574 |
| 90 | Ga0123353_10164817 | 3300010167 | Bacteria | 3524 |
| 91 | JGI24695J34938_10019413 | 3300002450 | Bacteria | 3369 |
| 92 | JGI24702J35022_10440450 | 3300002462 | Bacteria | 792 |
| 93 | JGI24705J35276_12224154 | 3300002504 | Bacteria | 2582 |
| 94 | JGI24705J35276_12226420 | 3300002504 | Bacteria | 2854 |
| 95 | Ga0072941_1407222 | 3300005201 | Bacteria | 1119 |
| 96 | Ga0562378_0729 | 3300056814 | Bacteria | 46988 |
| 97 | Ga0562375_0204 | 3300056856 | Bacteria | 167226 |
| 98 | Ga0466701_077471 | 3300042598 | Bacteria | 3966 |
| 99 | Ga0466706_046732 | 3300042599 | Bacteria | 3132 |
| 100 | Ga0466714_094399 | 3300042603 | Bacteria | 1258 |
| 101 | Ga0466717_095727 | 3300042604 | Bacteria | 2423 |
| 102 | Ga0466717_283434 | 3300042604 | Unclassified | 1456 |
| 103 | Ga0466698_178595 | 3300042610 | Bacteria | 1102 |
| 104 | Ga0466697_053227 | 3300042611 | Bacteria | 1451 |
| 105 | Ga0466731_342402 | 3300042622 | Bacteria | 1726 |
| 106 | Ga0123355_12224814 | 3300009826 | Bacteria | 500 |
| 107 | Ga0123356_10267201 | 3300010049 | Bacteria | 1798 |
| 108 | Ga0123356_10603013 | 3300010049 | Bacteria | 1263 |
| 109 | Ga0123353_10266853 | 3300010167 | Bacteria | 2640 |
| 110 | Ga0123353_10729635 | 3300010167 | Unclassified | 1384 |
| 111 | Ga0466710_142767 | 3300042613 | Bacteria | 3432 |
| 112 | Ga0415639_250131 | 3300038395 | Bacteria | 1297 |
| 113 | Ga0466693_413359 | 3300042592 | Bacteria | 1366 |
| 114 | Ga0466700_131951 | 3300042600 | Bacteria | 4074 |
| 115 | Ga0466717_204641 | 3300042604 | Unclassified | 5478 |
| 116 | Ga0466721_198460 | 3300042608 | Bacteria | 1451 |
| 117 | Ga0466731_204113 | 3300042622 | Bacteria | 1110 |
| 118 | Ga0466731_371171 | 3300042622 | Bacteria | 1329 |
| 119 | Ga0466731_415311 | 3300042622 | Bacteria | 1761 |
| 120 | Ga0466735_170774 | 3300042624 | Bacteria | 2953 |
| 121 | Ga0466725_115227 | 3300042654 | Bacteria | 1082 |
| 122 | Ga0123355_10295505 | 3300009826 | Bacteria | 2216 |
| 123 | Ga0123355_10716573 | 3300009826 | Bacteria | 1143 |
| 124 | Ga0123356_10093334 | 3300010049 | Bacteria | 2872 |
| 125 | Ga0123356_10625545 | 3300010049 | Unclassified | 1242 |
| 126 | Ga0123353_10511587 | 3300010167 | Unclassified | 1745 |
| 127 | Ga0123353_11006971 | 3300010167 | Bacteria | 1119 |
| 128 | Ga0123353_11213065 | 3300010167 | Bacteria | 989 |
| 129 | Ga0123353_12292140 | 3300010167 | Bacteria | 650 |
| 130 | Ga0123354_10451680 | 3300010882 | Unclassified | 1040 |
| 131 | 2227550465 | 2225789004 | Bacteria | 2859 |
| 132 | JGI24705J35276_12133797 | 3300002504 | Unclassified | 1114 |
| 133 | JGI24696J40584_12788612 | 3300002834 | Bacteria | 848 |
| 134 | Ga0068305_10167008 | 3300005083 | Bacteria | 792 |
| 135 | Ga0415639_064703 | 3300038395 | Bacteria | 1133 |
| 136 | Ga0466656_106992 | 3300042550 | Bacteria | 1623 |
| 137 | Ga0466657_053602 | 3300042582 | Bacteria | 3024 |
| 138 | Ga0466694_172660 | 3300042594 | Bacteria | 1004 |
| 139 | Ga0466706_196746 | 3300042599 | Unclassified | 1135 |
| 140 | Ga0466714_009749 | 3300042603 | Unclassified | 3427 |
| 141 | Ga0466717_089209 | 3300042604 | Bacteria | 1061 |
| 142 | Ga0466721_292526 | 3300042608 | Bacteria | 1104 |
| 143 | Ga0466731_016708 | 3300042622 | Bacteria | 2611 |
| 144 | Ga0123356_10132615 | 3300010049 | Bacteria | 2444 |
| 145 | Ga0123356_10178058 | 3300010049 | Bacteria | 2145 |
| 146 | Ga0123356_10680282 | 3300010049 | Unclassified | 1197 |
| 147 | Ga0123356_11511993 | 3300010049 | Bacteria | 829 |
| 148 | Ga0123353_10108835 | 3300010167 | Bacteria | 4466 |
| 149 | Ga0123353_10188718 | 3300010167 | Unclassified | 3256 |
| 150 | Ga0123353_10224665 | 3300010167 | Bacteria | 2933 |
| 151 | Ga0123353_10343265 | 3300010167 | Unclassified | 2254 |
| 152 | Ga0123353_11849734 | 3300010167 | Bacteria | 748 |
| 153 | Ga0123354_10146826 | 3300010882 | Unclassified | 2882 |
| 154 | Ga0123354_10386627 | 3300010882 | Bacteria | 1201 |
| 155 | JGI24702J35022_10018948 | 3300002462 | Bacteria | 3749 |
| 156 | JGI24696J40584_12949351 | 3300002834 | Unclassified | 2068 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042592 | Ga0466693_062266 | Ga0466693_062266_1535_1885 | 116 |
| 2 | 3300042604 | Ga0466717_204641 | Ga0466717_204641_1913_2263 | 116 |
| 3 | 3300005083 | Ga0068305_10167008 | Ga0068305_101670081 | 117 |
| 4 | 3300009784 | Ga0123357_10959091 | Ga0123357_109590912 | 117 |
| 5 | 3300042659 | Ga0466733_139199 | Ga0466733_139199_1242_1595 | 117 |
| 6 | iso_pr_bacteria | 2940230426 | 2940233493 | 117 |
| 7 | iso_pr_bacteria | 2940230426 | 2940233505 | 117 |
| 8 | iso_pr_bacteria | 2940233634 | 2940236676 | 117 |
| 9 | iso_pr_bacteria | 2940233634 | 2940236688 | 117 |
| 10 | iso_pr_bacteria | 2940277027 | 2940279751 | 117 |
| 11 | iso_pr_bacteria | 2940277027 | 2940279954 | 117 |
| 12 | iso_pr_bacteria | 2940280053 | 2940282990 | 117 |
| 13 | iso_pr_bacteria | 2940280053 | 2940283262 | 117 |
| 14 | iso_pr_bacteria | 2940283334 | 2940286381 | 117 |
| 15 | iso_pr_bacteria | 2940283334 | 2940286393 | 117 |
| 16 | iso_pr_bacteria | 2940286528 | 2940289329 | 117 |
| 17 | iso_pr_bacteria | 2940286528 | 2940289454 | 117 |
| 18 | iso_pr_bacteria | 2944625312 | 2944627958 | 117 |
| 19 | iso_pr_bacteria | 2944625312 | 2944628232 | 117 |
| 20 | 3300002450 | JGI24695J34938_10019413 | JGI24695J34938_100194133 | 118 |
| 21 | 3300010167 | Ga0123353_10266853 | Ga0123353_102668532 | 118 |
| 22 | 3300024582 | Ga0265387_1121408 | Ga0265387_11214082 | 118 |
| 23 | 3300038395 | Ga0415639_243509 | Ga0415639_243509_11_367 | 118 |
| 24 | 3300038395 | Ga0415639_250131 | Ga0415639_250131_317_673 | 118 |
| 25 | 3300038395 | Ga0415639_292938 | Ga0415639_292938_639_995 | 118 |
| 26 | 3300042592 | Ga0466693_009559 | Ga0466693_009559_526_882 | 118 |
| 27 | 3300042592 | Ga0466693_301197 | Ga0466693_301197_326_682 | 118 |
| 28 | 3300042592 | Ga0466693_323781 | Ga0466693_323781_1894_2250 | 118 |
| 29 | 3300042596 | Ga0466696_484856 | Ga0466696_484856_1208_1564 | 118 |
| 30 | 3300042599 | Ga0466706_046732 | Ga0466706_046732_2338_2694 | 118 |
| 31 | 3300042600 | Ga0466700_163682 | Ga0466700_163682_568_924 | 118 |
| 32 | 3300042602 | Ga0466713_155249 | Ga0466713_155249_452_808 | 118 |
| 33 | 3300042603 | Ga0466714_009749 | Ga0466714_009749_2444_2800 | 118 |
| 34 | 3300042603 | Ga0466714_066348 | Ga0466714_066348_820_1176 | 118 |
| 35 | 3300042603 | Ga0466714_094399 | Ga0466714_094399_216_572 | 118 |
| 36 | 3300042604 | Ga0466717_089209 | Ga0466717_089209_147_503 | 118 |
| 37 | 3300042604 | Ga0466717_095727 | Ga0466717_095727_248_604 | 118 |
| 38 | 3300042604 | Ga0466717_267483 | Ga0466717_267483_182_538 | 118 |
| 39 | 3300042608 | Ga0466721_009619 | Ga0466721_009619_696_1052 | 118 |
| 40 | 3300042608 | Ga0466721_119251 | Ga0466721_119251_448_804 | 118 |
| 41 | 3300042608 | Ga0466721_198460 | Ga0466721_198460_186_542 | 118 |
| 42 | 3300042608 | Ga0466721_292526 | Ga0466721_292526_592_948 | 118 |
| 43 | 3300042608 | Ga0466721_328726 | Ga0466721_328726_645_1001 | 118 |
| 44 | 3300042611 | Ga0466697_053227 | Ga0466697_053227_248_604 | 118 |
| 45 | 3300042622 | Ga0466731_044859 | Ga0466731_044859_203_559 | 118 |
| 46 | 3300042622 | Ga0466731_204113 | Ga0466731_204113_68_424 | 118 |
| 47 | 3300042622 | Ga0466731_208335 | Ga0466731_208335_801_1157 | 118 |
| 48 | 3300042622 | Ga0466731_342402 | Ga0466731_342402_545_901 | 118 |
| 49 | 3300042622 | Ga0466731_371171 | Ga0466731_371171_444_800 | 118 |
| 50 | 3300042622 | Ga0466731_415311 | Ga0466731_415311_897_1253 | 118 |
| 51 | 3300042624 | Ga0466735_170774 | Ga0466735_170774_724_1080 | 118 |
| 52 | 3300056814 | Ga0562378_0729 | Ga0562378_0729_34228_34584 | 118 |
| 53 | 3300056856 | Ga0562375_0204 | Ga0562375_0204_95471_95827 | 118 |
| 54 | iso_pr_bacteria | 2873581347 | 2873581795 | 118 |
| 55 | iso_pr_bacteria | 2873581347 | 2873582362 | 118 |
| 56 | iso_pr_bacteria | 2873581347 | 2873583087 | 118 |
| 57 | iso_pr_bacteria | 2873581347 | 2873583577 | 118 |
| 58 | iso_pr_bacteria | 2873581347 | 2873584415 | 118 |
| 59 | 3300002504 | JGI24705J35276_12133797 | JGI24705J35276_121337972 | 119 |
| 60 | 3300002504 | JGI24705J35276_12224154 | JGI24705J35276_122241542 | 119 |
| 61 | 3300002504 | JGI24705J35276_12225472 | JGI24705J35276_122254723 | 119 |
| 62 | 3300002834 | JGI24696J40584_12788612 | JGI24696J40584_127886122 | 119 |
| 63 | 3300002834 | JGI24696J40584_12949351 | JGI24696J40584_129493512 | 119 |
| 64 | 3300005083 | Ga0068305_10002282 | Ga0068305_100022822 | 119 |
| 65 | 3300005083 | Ga0068305_10211975 | Ga0068305_102119752 | 119 |
| 66 | 3300005200 | Ga0072940_1172820 | Ga0072940_11728203 | 119 |
| 67 | 3300005283 | Ga0065725_10000040 | Ga0065725_100000403 | 119 |
| 68 | 3300009784 | Ga0123357_10149550 | Ga0123357_101495503 | 119 |
| 69 | 3300009784 | Ga0123357_10158226 | Ga0123357_101582263 | 119 |
| 70 | 3300009784 | Ga0123357_10196396 | Ga0123357_101963962 | 119 |
| 71 | 3300009784 | Ga0123357_10303900 | Ga0123357_103039002 | 119 |
| 72 | 3300009784 | Ga0123357_10344182 | Ga0123357_103441822 | 119 |
| 73 | 3300009826 | Ga0123355_10295505 | Ga0123355_102955052 | 119 |
| 74 | 3300009826 | Ga0123355_12224814 | Ga0123355_122248141 | 119 |
| 75 | 3300010049 | Ga0123356_10060848 | Ga0123356_100608483 | 119 |
| 76 | 3300010049 | Ga0123356_10098549 | Ga0123356_100985493 | 119 |
| 77 | 3300010049 | Ga0123356_10132615 | Ga0123356_101326155 | 119 |
| 78 | 3300010049 | Ga0123356_10178058 | Ga0123356_101780582 | 119 |
| 79 | 3300010049 | Ga0123356_10277149 | Ga0123356_102771492 | 119 |
| 80 | 3300010049 | Ga0123356_10315921 | Ga0123356_103159212 | 119 |
| 81 | 3300010049 | Ga0123356_10603013 | Ga0123356_106030132 | 119 |
| 82 | 3300010049 | Ga0123356_11060488 | Ga0123356_110604881 | 119 |
| 83 | 3300010049 | Ga0123356_11071661 | Ga0123356_110716611 | 119 |
| 84 | 3300010049 | Ga0123356_11415475 | Ga0123356_114154752 | 119 |
| 85 | 3300010167 | Ga0123353_10164817 | Ga0123353_101648174 | 119 |
| 86 | 3300010167 | Ga0123353_10188718 | Ga0123353_101887183 | 119 |
| 87 | 3300010167 | Ga0123353_10224665 | Ga0123353_102246652 | 119 |
| 88 | 3300010167 | Ga0123353_10343265 | Ga0123353_103432652 | 119 |
| 89 | 3300010167 | Ga0123353_10511587 | Ga0123353_105115873 | 119 |
| 90 | 3300010167 | Ga0123353_10729475 | Ga0123353_107294752 | 119 |
| 91 | 3300010167 | Ga0123353_10733236 | Ga0123353_107332362 | 119 |
| 92 | 3300010167 | Ga0123353_10846124 | Ga0123353_108461242 | 119 |
| 93 | 3300010167 | Ga0123353_11849734 | Ga0123353_118497342 | 119 |
| 94 | 3300010167 | Ga0123353_12838448 | Ga0123353_128384481 | 119 |
| 95 | 3300010882 | Ga0123354_10084195 | Ga0123354_100841953 | 119 |
| 96 | 3300010882 | Ga0123354_10386627 | Ga0123354_103866272 | 119 |
| 97 | 3300038395 | Ga0415639_141317 | Ga0415639_141317_50_409 | 119 |
| 98 | 3300042599 | Ga0466706_196746 | Ga0466706_196746_493_852 | 119 |
| 99 | 3300042604 | Ga0466717_205238 | Ga0466717_205238_2012_2371 | 119 |
| 100 | 3300042613 | Ga0466710_142767 | Ga0466710_142767_783_1142 | 119 |
| 101 | 3300042624 | Ga0466735_189564 | Ga0466735_189564_1594_1953 | 119 |
| 102 | 3300005201 | Ga0072941_1233573 | Ga0072941_12335733 | 120 |
| 103 | 3300010049 | Ga0123356_10093334 | Ga0123356_100933343 | 120 |
| 104 | 3300010049 | Ga0123356_10267201 | Ga0123356_102672013 | 120 |
| 105 | 3300010049 | Ga0123356_11511993 | Ga0123356_115119932 | 120 |
| 106 | 3300010167 | Ga0123353_10160912 | Ga0123353_101609122 | 120 |
| 107 | 3300010167 | Ga0123353_10178577 | Ga0123353_101785773 | 120 |
| 108 | 3300010167 | Ga0123353_10568672 | Ga0123353_105686722 | 120 |
| 109 | 3300010167 | Ga0123353_10729635 | Ga0123353_107296353 | 120 |
| 110 | 3300010167 | Ga0123353_12924380 | Ga0123353_129243801 | 120 |
| 111 | 3300010882 | Ga0123354_10451680 | Ga0123354_104516801 | 120 |
| 112 | 3300042550 | Ga0466656_106992 | Ga0466656_106992_731_1135 | 123 |
| 113 | 3300038395 | Ga0415639_036570 | Ga0415639_036570_571_951 | 126 |
| 114 | 3300042592 | Ga0466693_047728 | Ga0466693_047728_565_951 | 128 |
| 115 | 2225789004 | 2227550465 | 2228079558 | 129 |
| 116 | 3300042610 | Ga0466698_146649 | Ga0466698_146649_809_1198 | 129 |
| 117 | iso_pr_bacteria | 2820314258 | 2820314631 | 130 |
| 118 | 3300038395 | Ga0415639_064703 | Ga0415639_064703_673_1068 | 131 |
| 119 | 3300042604 | Ga0466717_128112 | Ga0466717_128112_694_1089 | 131 |
| 120 | 3300042610 | Ga0466698_178595 | Ga0466698_178595_272_667 | 131 |
| 121 | 3300002504 | JGI24705J35276_12193832 | JGI24705J35276_121938322 | 132 |
| 122 | 3300042611 | Ga0466697_046103 | Ga0466697_046103_2024_2422 | 132 |
| 123 | 3300002462 | JGI24702J35022_10440450 | JGI24702J35022_104404502 | 133 |
| 124 | 3300010167 | Ga0123353_11006971 | Ga0123353_110069712 | 133 |
| 125 | 3300010882 | Ga0123354_10146826 | Ga0123354_101468263 | 133 |
| 126 | 3300042592 | Ga0466693_340515 | Ga0466693_340515_472_873 | 133 |
| 127 | 3300042592 | Ga0466693_413359 | Ga0466693_413359_704_1105 | 133 |
| 128 | 3300042600 | Ga0466700_131951 | Ga0466700_131951_759_1160 | 133 |
| 129 | 3300005201 | Ga0072941_1407222 | Ga0072941_14072222 | 134 |
| 130 | 3300038395 | Ga0415639_122142 | Ga0415639_122142_1863_2267 | 134 |
| 131 | 3300042582 | Ga0466657_053602 | Ga0466657_053602_1942_2346 | 134 |
| 132 | 3300042582 | Ga0466657_192166 | Ga0466657_192166_1562_1966 | 134 |
| 133 | 3300042582 | Ga0466657_309142 | Ga0466657_309142_1959_2363 | 134 |
| 134 | 3300042592 | Ga0466693_024392 | Ga0466693_024392_879_1283 | 134 |
| 135 | 3300042598 | Ga0466701_017781 | Ga0466701_017781_2849_3253 | 134 |
| 136 | 3300042598 | Ga0466701_026539 | Ga0466701_026539_1312_1716 | 134 |
| 137 | 3300042598 | Ga0466701_077471 | Ga0466701_077471_2342_2746 | 134 |
| 138 | 3300042608 | Ga0466721_044157 | Ga0466721_044157_325_729 | 134 |
| 139 | 3300042611 | Ga0466697_123596 | Ga0466697_123596_865_1269 | 134 |
| 140 | 3300042613 | Ga0466710_444314 | Ga0466710_444314_696_1100 | 134 |
| 141 | 3300042617 | Ga0466718_037784 | Ga0466718_037784_1541_1945 | 134 |
| 142 | 3300042617 | Ga0466718_140194 | Ga0466718_140194_622_1026 | 134 |
| 143 | 3300042622 | Ga0466731_016708 | Ga0466731_016708_363_767 | 134 |
| 144 | 3300042622 | Ga0466731_019354 | Ga0466731_019354_33_437 | 134 |
| 145 | 3300042622 | Ga0466731_297849 | Ga0466731_297849_326_730 | 134 |
| 146 | 3300042635 | Ga0466702_411990 | Ga0466702_411990_647_1051 | 134 |
| 147 | 3300042654 | Ga0466725_115227 | Ga0466725_115227_590_994 | 134 |
| 148 | 3300042654 | Ga0466725_429587 | Ga0466725_429587_2345_2749 | 134 |
| 149 | iso_pr_bacteria | 2820058318 | 2820058427 | 134 |
| 150 | 3300002449 | JGI24698J34947_10114436 | JGI24698J34947_101144362 | 135 |
| 151 | 3300002462 | JGI24702J35022_10015371 | JGI24702J35022_100153713 | 135 |
| 152 | 3300002462 | JGI24702J35022_10024533 | JGI24702J35022_100245333 | 135 |
| 153 | 3300002504 | JGI24705J35276_12225613 | JGI24705J35276_122256132 | 135 |
| 154 | 3300002504 | JGI24705J35276_12226420 | JGI24705J35276_122264202 | 135 |
| 155 | 3300002504 | JGI24705J35276_12227863 | JGI24705J35276_122278633 | 135 |
| 156 | 3300005201 | Ga0072941_1127000 | Ga0072941_11270003 | 135 |
| 157 | 3300009784 | Ga0123357_10115705 | Ga0123357_101157054 | 135 |
| 158 | 3300010167 | Ga0123353_10243003 | Ga0123353_102430033 | 135 |
| 159 | 3300010167 | Ga0123353_12292140 | Ga0123353_122921401 | 135 |
| 160 | 3300042592 | Ga0466693_417504 | Ga0466693_417504_179_586 | 135 |
| 161 | 3300042594 | Ga0466694_166972 | Ga0466694_166972_1133_1540 | 135 |
| 162 | 3300042594 | Ga0466694_172660 | Ga0466694_172660_44_451 | 135 |
| 163 | 3300042604 | Ga0466717_283434 | Ga0466717_283434_772_1179 | 135 |
| 164 | 3300042611 | Ga0466697_080157 | Ga0466697_080157_1370_1777 | 135 |
| 165 | 3300002462 | JGI24702J35022_10018948 | JGI24702J35022_100189482 | 136 |
| 166 | 3300009826 | Ga0123355_10716573 | Ga0123355_107165732 | 136 |
| 167 | 3300010049 | Ga0123356_10054458 | Ga0123356_100544583 | 136 |
| 168 | 3300010049 | Ga0123356_10253656 | Ga0123356_102536562 | 136 |
| 169 | 3300010049 | Ga0123356_10321205 | Ga0123356_103212052 | 136 |
| 170 | 3300010049 | Ga0123356_10625545 | Ga0123356_106255451 | 136 |
| 171 | 3300010049 | Ga0123356_10680282 | Ga0123356_106802822 | 136 |
| 172 | 3300010167 | Ga0123353_10108835 | Ga0123353_101088353 | 136 |
| 173 | 3300010167 | Ga0123353_10279214 | Ga0123353_102792142 | 136 |
| 174 | 3300010167 | Ga0123353_10291849 | Ga0123353_102918492 | 136 |
| 175 | 3300010167 | Ga0123353_10997939 | Ga0123353_109979392 | 136 |
| 176 | 3300010167 | Ga0123353_11213065 | Ga0123353_112130651 | 136 |
| 177 | 3300010882 | Ga0123354_10434536 | Ga0123354_104345362 | 136 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05717 | TnpB_IS66 | IS66 Orf2 like protein | 27 | 124 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.74 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.