Protein Family IF02562

Metagenome Isolate
203 Members
53 Samples
200 Scaffolds
155.21 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10507139|Ga0123355_105071392
Length
179 aa
Sequence
VPPKFLQIIRNYNEVILQNDVISMRGKHIKIELNAITRSKLKKFAKTGKKSVHLVNRAKIILELDEADGRKPLTQVQIAEKVGVTRQTVNNAKKAFLEEKDLSIFLQRKKRETPPVAPKITGEVEAHIIALACSPVPEGYAKWGVRLLANKCVELNYIDSISFKSVQRVLKKHNLSLT*

📊 Sample Types

Isolate 1.5%
Metagenome 98.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 55.8%
Kalotermitidae 23.1%
Unclassified 9.6%
Rhinotermitidae 3.8%
Termopsidae 3.8%
Hodotermitidae 1.9%
Passalidae 1.9%

🌳 Taxonomy

Archaea 48
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 38

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
2 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
3 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
4 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
5 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
6 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
14 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
15 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
18 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
19 2820080004 Unclassified Proteobacteria Lab288P4bin34 Isolate Unclassified
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
24 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
25 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
26 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
27 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
30 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
31 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
34 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
35 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
36 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
37 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
38 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
41 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
44 2820217359 Unclassified Kiritimatiellaeota Nt197P3bin101 Isolate Unclassified
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
49 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
50 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
51 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
52 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
53 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_068092 3300042611 Bacteria 2107
2 Ga0466705_009070 3300042612 Bacteria 24553
3 Ga0466691_107968 3300042593 Bacteria 3272
4 Ga0466695_007352 3300042595 Bacteria 1720
5 Ga0466699_052082 3300042597 Unclassified 1909
6 Ga0466699_351713 3300042597 Bacteria 1214
7 Ga0466699_372755 3300042597 Bacteria 1312
8 Ga0466731_062878 3300042622 Bacteria 1146
9 Ga0466704_222603 3300042643 Bacteria 60546
10 Ga0466717_000329 3300042604 Archaea 1672
11 Ga0466721_403238 3300042608 Archaea 1609
12 Ga0123355_10251922 3300009826 Bacteria 2484
13 Ga0123356_10378893 3300010049 Unclassified 1547
14 Ga0123356_10412958 3300010049 Unclassified 1490
15 Ga0123353_10489049 3300010167 Bacteria 1797
16 Ga0123353_10593656 3300010167 Archaea 1585
17 Ga0123353_10745301 3300010167 Bacteria 1364
18 Ga0123353_10794592 3300010167 Bacteria 1308
19 Ga0123354_10305477 3300010882 Archaea 1496
20 Ga0123354_10519435 3300010882 Archaea 916
21 IMNBL1DRAFT_c0033024 3300000062 Bacteria 1859
22 IMNBL1DRAFT_c0122553 3300000062 Archaea 682
23 JGI24705J35276_12165015 3300002504 Bacteria 1255
24 Ga0072941_1033068 3300005201 Bacteria 1271
25 Ga0466715_379577 3300042616 Bacteria 1302
26 Ga0466723_085569 3300042618 Bacteria 5934
27 Ga0466728_099958 3300042620 Bacteria 5708
28 Ga0466693_206790 3300042592 Bacteria 1796
29 Ga0466729_248208 3300042621 Bacteria 2691
30 Ga0466734_024633 3300042623 Bacteria 1453
31 Ga0466702_343347 3300042635 Bacteria 1228
32 Ga0466703_224610 3300042636 Bacteria 1912
33 Ga0466725_348572 3300042654 Unclassified 1299
34 Ga0466706_113222 3300042599 Unclassified 1863
35 Ga0466700_452641 3300042600 Unclassified 1498
36 Ga0466721_133448 3300042608 Unclassified 2017
37 Ga0466721_272342 3300042608 Archaea 1150
38 Ga0123356_10320562 3300010049 Bacteria 1663
39 Ga0123353_10710699 3300010167 Bacteria 1408
40 Ga0123353_10785858 3300010167 Bacteria 1317
41 Ga0123353_10860955 3300010167 Bacteria 1240
42 Ga0123353_11129165 3300010167 Unclassified 1037
43 Ga0123354_10489154 3300010882 Unclassified 967
44 JGI24702J35022_10125634 3300002462 Bacteria 1420
45 JGI24696J40584_12301428 3300002834 Archaea 519
46 Ga0466715_045269 3300042616 Bacteria 1832
47 Ga0466715_060905 3300042616 Archaea 1266
48 Ga0466723_174372 3300042618 Bacteria 14478
49 Ga0466690_058465 3300042590 Unclassified 2266
50 Ga0466690_287201 3300042590 Bacteria 1556
51 Ga0466694_076919 3300042594 Unclassified 1532
52 Ga0466699_373595 3300042597 Bacteria 1755
53 Ga0466703_400281 3300042636 Unclassified 2521
54 Ga0466725_117264 3300042654 Bacteria 1973
55 Ga0466725_430677 3300042654 Bacteria 1318
56 Ga0466722_227887 3300042609 Bacteria 1693
57 Ga0123357_10287040 3300009784 Bacteria 1688
58 Ga0123357_10447969 3300009784 Bacteria 1123
59 Ga0123355_10507139 3300009826 Bacteria 1484
60 Ga0123353_10021638 3300010167 Bacteria 9657
61 Ga0123353_10383277 3300010167 Bacteria 2101
62 Ga0123353_10678439 3300010167 Bacteria 1452
63 Ga0123353_10754002 3300010167 Archaea 1354
64 Ga0123353_11134864 3300010167 Archaea 1034
65 Ga0123353_12310912 3300010167 Bacteria 646
66 Ga0123354_10236796 3300010882 Unclassified 1890
67 Ga0123354_10824220 3300010882 Unclassified 621
68 IMNBL1DRAFT_c0052768 3300000062 Archaea 1272
69 JGI24696J40584_12439764 3300002834 Archaea 571
70 JGI24696J40584_12915788 3300002834 Unclassified 1297
71 Ga0466712_154943 3300042614 Bacteria 1528
72 Ga0466715_137408 3300042616 Bacteria 2873
73 Ga0466705_053669 3300042612 Archaea 1363
74 Ga0466705_220379 3300042612 Bacteria 1616
75 Ga0415639_085245 3300038395 Archaea 1351
76 Ga0466694_117373 3300042594 Bacteria 1267
77 Ga0466699_096744 3300042597 Unclassified 8909
78 Ga0466699_165689 3300042597 Bacteria 1626
79 Ga0466704_201294 3300042643 Bacteria 5151
80 Ga0466704_415597 3300042643 Bacteria 2875
81 Ga0466707_172595 3300042601 Bacteria 2300
82 Ga0466717_239099 3300042604 Unclassified 1210
83 Ga0466719_011523 3300042606 Archaea 1558
84 Ga0466719_205031 3300042606 Archaea 1570
85 Ga0123357_10497322 3300009784 Bacteria 1016
86 Ga0123355_10745915 3300009826 Unclassified 1109
87 Ga0123356_10103005 3300010049 Unclassified 2741
88 Ga0123356_10227955 3300010049 Bacteria 1925
89 Ga0123356_11223388 3300010049 Bacteria 916
90 Ga0123356_12462406 3300010049 Archaea 651
91 Ga0123353_10613592 3300010167 Bacteria 1551
92 Ga0123353_10866692 3300010167 Bacteria 1235
93 Ga0123353_11159228 3300010167 Archaea 1019
94 Ga0123353_11257711 3300010167 Bacteria 965
95 Ga0123353_11826273 3300010167 Bacteria 754
96 Ga0068305_11139384 3300005083 Archaea 883
97 Ga0466715_029416 3300042616 Unclassified 1236
98 Ga0466728_136969 3300042620 Bacteria 2048
99 Ga0466728_163983 3300042620 Unclassified 5563
100 Ga0466693_073999 3300042592 Bacteria 1124
101 Ga0466693_193082 3300042592 Unclassified 1227
102 Ga0466693_353858 3300042592 Bacteria 1523
103 Ga0466693_396594 3300042592 Unclassified 1345
104 Ga0466693_423692 3300042592 Archaea 1453
105 Ga0466703_103134 3300042636 Bacteria 1390
106 Ga0466703_252099 3300042636 Unclassified 3110
107 Ga0466704_067806 3300042643 Bacteria 1850
108 Ga0466704_286056 3300042643 Unclassified 2590
109 Ga0466700_212416 3300042600 Bacteria 1321
110 Ga0466716_425573 3300042605 Bacteria 2118
111 Ga0123356_10204471 3300010049 Bacteria 2017
112 Ga0123356_10436546 3300010049 Unclassified 1455
113 Ga0123356_10663777 3300010049 Bacteria 1210
114 Ga0123353_10038381 3300010167 Bacteria 7527
115 Ga0123353_11182722 3300010167 Archaea 1005
116 Ga0123353_13379800 3300010167 Archaea 507
117 JGI24695J34938_10046395 3300002450 Bacteria 1923
118 JGI24702J35022_10181558 3300002462 Archaea 1196
119 JGI24696J40584_12415234 3300002834 Archaea 561
120 Ga0466712_222696 3300042614 Bacteria 2614
121 Ga0466718_032415 3300042617 Bacteria 1369
122 Ga0466705_239018 3300042612 Bacteria 2136
123 Ga0415639_007438 3300038395 Unclassified 4119
124 Ga0415639_017549 3300038395 Archaea 1988
125 Ga0466656_367857 3300042550 Bacteria 1771
126 Ga0466693_054086 3300042592 Archaea 1237
127 Ga0466694_004358 3300042594 Archaea 1831
128 Ga0466694_046460 3300042594 Bacteria 1385
129 Ga0466694_107441 3300042594 Bacteria 1343
130 Ga0466695_131493 3300042595 Archaea 1329
131 Ga0466735_011611 3300042624 Archaea 1364
132 Ga0466716_235654 3300042605 Unclassified 1851
133 Ga0466698_200603 3300042610 Bacteria 1373
134 Ga0466697_049218 3300042611 Archaea 1362
135 Ga0123355_10815779 3300009826 Bacteria 1036
136 Ga0123353_10374524 3300010167 Bacteria 2133
137 Ga0123353_11608703 3300010167 Archaea 820
138 IMNBL1DRAFT_c0050631 3300000062 Bacteria 1314
139 JGI24695J34938_10186034 3300002450 Archaea 861
140 Ga0072940_1037094 3300005200 Bacteria 2014
141 Ga0466705_219876 3300042612 Unclassified 1417
142 Ga0466705_283635 3300042612 Bacteria 2146
143 Ga0466656_259915 3300042550 Bacteria 1452
144 Ga0466693_343180 3300042592 Archaea 1914
145 Ga0466694_060692 3300042594 Bacteria 1247
146 Ga0466696_224078 3300042596 Unclassified 2173
147 Ga0466735_148626 3300042624 Bacteria 1396
148 Ga0466702_449950 3300042635 Bacteria 1152
149 Ga0466703_360819 3300042636 Archaea 1044
150 Ga0466709_094755 3300042648 Bacteria 1158
151 Ga0466725_079661 3300042654 Archaea 1208
152 Ga0466714_125854 3300042603 Bacteria 1067
153 Ga0466716_536974 3300042605 Bacteria 3484
154 Ga0466722_010887 3300042609 Unclassified 1936
155 Ga0466698_046546 3300042610 Bacteria 1498
156 Ga0123355_10607718 3300009826 Bacteria 1295
157 Ga0123356_11488142 3300010049 Bacteria 835
158 Ga0123356_12482403 3300010049 Bacteria 649
159 Ga0123353_10510987 3300010167 Bacteria 1747
160 Ga0123353_10650955 3300010167 Archaea 1492
161 Ga0123353_10897540 3300010167 Bacteria 1207
162 Ga0123353_11898700 3300010167 Archaea 735
163 Ga0123354_10235365 3300010882 Bacteria 1902
164 Ga0123354_10292542 3300010882 Unclassified 1558
165 Ga0123354_10321860 3300010882 Archaea 1426
166 JGI24698J34947_10099381 3300002449 Bacteria 1312
167 JGI24695J34938_10082384 3300002450 Bacteria 1328
168 JGI24695J34938_10087999 3300002450 Bacteria 1277
169 Ga0466718_015958 3300042617 Bacteria 1610
170 Ga0466723_153509 3300042618 Bacteria 5123
171 Ga0466705_045825 3300042612 Unclassified 1258
172 Ga0466705_172941 3300042612 Bacteria 2240
173 Ga0466693_158102 3300042592 Unclassified 1441
174 Ga0466693_269269 3300042592 Unclassified 2659
175 Ga0466691_138542 3300042593 Archaea 1417
176 Ga0466694_268033 3300042594 Archaea 1003
177 Ga0466695_147505 3300042595 Bacteria 1284
178 Ga0466696_092692 3300042596 Bacteria 1798
179 Ga0466699_000935 3300042597 Bacteria 2688
180 Ga0466699_149627 3300042597 Bacteria 1329
181 Ga0466734_062899 3300042623 Bacteria 1652
182 Ga0466703_069315 3300042636 Bacteria 3022
183 Ga0466703_236726 3300042636 Archaea 1678
184 Ga0466725_356151 3300042654 Archaea 1457
185 Ga0466727_092060 3300042655 Bacteria 1171
186 Ga0466700_023989 3300042600 Bacteria 1545
187 Ga0466698_425276 3300042610 Archaea 2033
188 Ga0123355_10634093 3300009826 Archaea 1254
189 Ga0123356_10162192 3300010049 Bacteria 2235
190 Ga0123356_10181434 3300010049 Bacteria 2127
191 Ga0123356_10355165 3300010049 Bacteria 1591
192 Ga0123356_10375453 3300010049 Unclassified 1553
193 Ga0123356_10848656 3300010049 Bacteria 1085
194 Ga0123353_10416009 3300010167 Bacteria 1994
195 Ga0123353_11633235 3300010167 Archaea 812
196 Ga0123354_10264088 3300010882 Archaea 1711
197 Ga0123354_10434248 3300010882 Archaea 1078
198 Ga0123354_10477690 3300010882 Unclassified 988
199 JGI24702J35022_10082359 3300002462 Bacteria 1744
200 Ga0466723_249627 3300042618 Unclassified 1247

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_415597 Ga0466704_415597_1297_1731 144
2 3300010167 Ga0123353_10785858 Ga0123353_107858582 145
3 3300010882 Ga0123354_10292542 Ga0123354_102925422 145
4 3300042648 Ga0466709_094755 Ga0466709_094755_407_844 145
5 3300000062 IMNBL1DRAFT_c0050631 IMNBL1DRAFT_00506312 147
6 3300010167 Ga0123353_11159228 Ga0123353_111592282 147
7 3300042601 Ga0466707_172595 Ga0466707_172595_38_481 147
8 3300042594 Ga0466694_004358 Ga0466694_004358_1153_1599 148
9 3300042636 Ga0466703_400281 Ga0466703_400281_779_1225 148
10 3300042606 Ga0466719_205031 Ga0466719_205031_755_1204 149
11 3300042612 Ga0466705_283635 Ga0466705_283635_1091_1540 149
12 3300042616 Ga0466715_379577 Ga0466715_379577_257_706 149
13 3300042620 Ga0466728_163983 Ga0466728_163983_4234_4683 149
14 3300042636 Ga0466703_360819 Ga0466703_360819_555_1004 149
15 3300042610 Ga0466698_425276 Ga0466698_425276_1328_1780 150
16 3300042636 Ga0466703_103134 Ga0466703_103134_60_512 150
17 3300042617 Ga0466718_032415 Ga0466718_032415_200_655 151
18 3300009826 Ga0123355_10251922 Ga0123355_102519224 152
19 3300010167 Ga0123353_11608703 Ga0123353_116087031 152
20 3300038395 Ga0415639_007438 Ga0415639_007438_448_906 152
21 3300010167 Ga0123353_10866692 Ga0123353_108666921 153
22 3300042550 Ga0466656_259915 Ga0466656_259915_136_597 153
23 3300042550 Ga0466656_367857 Ga0466656_367857_800_1261 153
24 3300042592 Ga0466693_073999 Ga0466693_073999_507_968 153
25 3300042592 Ga0466693_343180 Ga0466693_343180_1189_1650 153
26 3300042593 Ga0466691_107968 Ga0466691_107968_2145_2606 153
27 3300042594 Ga0466694_117373 Ga0466694_117373_791_1252 153
28 3300042595 Ga0466695_007352 Ga0466695_007352_136_597 153
29 3300042596 Ga0466696_092692 Ga0466696_092692_676_1137 153
30 3300042597 Ga0466699_052082 Ga0466699_052082_237_698 153
31 3300042597 Ga0466699_149627 Ga0466699_149627_527_988 153
32 3300042597 Ga0466699_165689 Ga0466699_165689_817_1278 153
33 3300042597 Ga0466699_351713 Ga0466699_351713_581_1042 153
34 3300042600 Ga0466700_212416 Ga0466700_212416_777_1238 153
35 3300042603 Ga0466714_125854 Ga0466714_125854_361_822 153
36 3300042604 Ga0466717_239099 Ga0466717_239099_193_654 153
37 3300042611 Ga0466697_068092 Ga0466697_068092_21_482 153
38 3300042616 Ga0466715_029416 Ga0466715_029416_703_1164 153
39 3300042622 Ga0466731_062878 Ga0466731_062878_577_1038 153
40 3300042623 Ga0466734_062899 Ga0466734_062899_457_918 153
41 3300042635 Ga0466702_449950 Ga0466702_449950_371_832 153
42 3300042636 Ga0466703_252099 Ga0466703_252099_2260_2721 153
43 3300042654 Ga0466725_117264 Ga0466725_117264_634_1095 153
44 3300042654 Ga0466725_348572 Ga0466725_348572_779_1240 153
45 3300042654 Ga0466725_430677 Ga0466725_430677_130_591 153
46 3300002450 JGI24695J34938_10046395 JGI24695J34938_100463952 154
47 3300002462 JGI24702J35022_10125634 JGI24702J35022_101256341 154
48 3300002834 JGI24696J40584_12301428 JGI24696J40584_123014281 154
49 3300002834 JGI24696J40584_12415234 JGI24696J40584_124152341 154
50 3300009784 Ga0123357_10447969 Ga0123357_104479692 154
51 3300009784 Ga0123357_10497322 Ga0123357_104973221 154
52 3300010049 Ga0123356_10204471 Ga0123356_102044712 154
53 3300010049 Ga0123356_10227955 Ga0123356_102279553 154
54 3300010049 Ga0123356_10355165 Ga0123356_103551653 154
55 3300010049 Ga0123356_10848656 Ga0123356_108486562 154
56 3300010049 Ga0123356_11488142 Ga0123356_114881421 154
57 3300010167 Ga0123353_10374524 Ga0123353_103745241 154
58 3300010167 Ga0123353_10510987 Ga0123353_105109872 154
59 3300010167 Ga0123353_10650955 Ga0123353_106509552 154
60 3300010167 Ga0123353_10678439 Ga0123353_106784391 154
61 3300010167 Ga0123353_10710699 Ga0123353_107106992 154
62 3300010167 Ga0123353_10745301 Ga0123353_107453012 154
63 3300010167 Ga0123353_11257711 Ga0123353_112577112 154
64 3300010167 Ga0123353_11826273 Ga0123353_118262732 154
65 3300010167 Ga0123353_12310912 Ga0123353_123109121 154
66 3300010882 Ga0123354_10235365 Ga0123354_102353653 154
67 3300010882 Ga0123354_10477690 Ga0123354_104776902 154
68 3300000062 IMNBL1DRAFT_c0033024 IMNBL1DRAFT_00330244 155
69 3300010049 Ga0123356_10162192 Ga0123356_101621922 155
70 3300010049 Ga0123356_10412958 Ga0123356_104129582 155
71 3300010882 Ga0123354_10489154 Ga0123354_104891541 155
72 3300038395 Ga0415639_017549 Ga0415639_017549_828_1295 155
73 3300038395 Ga0415639_085245 Ga0415639_085245_258_725 155
74 3300042590 Ga0466690_058465 Ga0466690_058465_903_1370 155
75 3300042590 Ga0466690_287201 Ga0466690_287201_134_601 155
76 3300042592 Ga0466693_054086 Ga0466693_054086_124_591 155
77 3300042592 Ga0466693_158102 Ga0466693_158102_742_1209 155
78 3300042592 Ga0466693_193082 Ga0466693_193082_436_903 155
79 3300042592 Ga0466693_206790 Ga0466693_206790_410_877 155
80 3300042592 Ga0466693_269269 Ga0466693_269269_1993_2460 155
81 3300042592 Ga0466693_423692 Ga0466693_423692_270_737 155
82 3300042593 Ga0466691_138542 Ga0466691_138542_246_713 155
83 3300042594 Ga0466694_046460 Ga0466694_046460_686_1153 155
84 3300042594 Ga0466694_060692 Ga0466694_060692_82_549 155
85 3300042594 Ga0466694_076919 Ga0466694_076919_246_713 155
86 3300042594 Ga0466694_107441 Ga0466694_107441_512_979 155
87 3300042594 Ga0466694_268033 Ga0466694_268033_351_818 155
88 3300042595 Ga0466695_131493 Ga0466695_131493_196_663 155
89 3300042596 Ga0466696_224078 Ga0466696_224078_637_1104 155
90 3300042597 Ga0466699_000935 Ga0466699_000935_2168_2635 155
91 3300042597 Ga0466699_096744 Ga0466699_096744_7786_8253 155
92 3300042597 Ga0466699_372755 Ga0466699_372755_791_1258 155
93 3300042600 Ga0466700_023989 Ga0466700_023989_781_1248 155
94 3300042600 Ga0466700_452641 Ga0466700_452641_250_717 155
95 3300042605 Ga0466716_235654 Ga0466716_235654_851_1318 155
96 3300042605 Ga0466716_425573 Ga0466716_425573_203_670 155
97 3300042606 Ga0466719_011523 Ga0466719_011523_934_1401 155
98 3300042608 Ga0466721_133448 Ga0466721_133448_1172_1639 155
99 3300042608 Ga0466721_272342 Ga0466721_272342_126_593 155
100 3300042608 Ga0466721_403238 Ga0466721_403238_902_1369 155
101 3300042609 Ga0466722_010887 Ga0466722_010887_769_1236 155
102 3300042609 Ga0466722_227887 Ga0466722_227887_52_519 155
103 3300042610 Ga0466698_046546 Ga0466698_046546_828_1295 155
104 3300042610 Ga0466698_200603 Ga0466698_200603_826_1293 155
105 3300042611 Ga0466697_049218 Ga0466697_049218_776_1243 155
106 3300042612 Ga0466705_045825 Ga0466705_045825_325_792 155
107 3300042612 Ga0466705_053669 Ga0466705_053669_583_1050 155
108 3300042612 Ga0466705_172941 Ga0466705_172941_711_1178 155
109 3300042612 Ga0466705_219876 Ga0466705_219876_272_739 155
110 3300042612 Ga0466705_220379 Ga0466705_220379_653_1120 155
111 3300042612 Ga0466705_239018 Ga0466705_239018_382_849 155
112 3300042614 Ga0466712_154943 Ga0466712_154943_893_1360 155
113 3300042614 Ga0466712_222696 Ga0466712_222696_904_1371 155
114 3300042616 Ga0466715_045269 Ga0466715_045269_1165_1632 155
115 3300042616 Ga0466715_060905 Ga0466715_060905_709_1176 155
116 3300042616 Ga0466715_137408 Ga0466715_137408_2322_2789 155
117 3300042617 Ga0466718_015958 Ga0466718_015958_789_1256 155
118 3300042618 Ga0466723_085569 Ga0466723_085569_3988_4455 155
119 3300042618 Ga0466723_153509 Ga0466723_153509_703_1170 155
120 3300042618 Ga0466723_174372 Ga0466723_174372_13919_14386 155
121 3300042618 Ga0466723_249627 Ga0466723_249627_506_973 155
122 3300042620 Ga0466728_099958 Ga0466728_099958_3654_4121 155
123 3300042620 Ga0466728_136969 Ga0466728_136969_678_1145 155
124 3300042621 Ga0466729_248208 Ga0466729_248208_624_1091 155
125 3300042623 Ga0466734_024633 Ga0466734_024633_731_1198 155
126 3300042624 Ga0466735_011611 Ga0466735_011611_626_1093 155
127 3300042635 Ga0466702_343347 Ga0466702_343347_126_593 155
128 3300042636 Ga0466703_069315 Ga0466703_069315_1554_2021 155
129 3300042636 Ga0466703_224610 Ga0466703_224610_155_622 155
130 3300042643 Ga0466704_067806 Ga0466704_067806_674_1141 155
131 3300042643 Ga0466704_201294 Ga0466704_201294_1313_1780 155
132 3300042643 Ga0466704_222603 Ga0466704_222603_49516_49983 155
133 3300042643 Ga0466704_286056 Ga0466704_286056_979_1446 155
134 3300042654 Ga0466725_079661 Ga0466725_079661_259_726 155
135 3300042654 Ga0466725_356151 Ga0466725_356151_217_684 155
136 iso_pr_bacteria 2820080004 2820081630 155
137 iso_pr_bacteria 2820324456 2820325003 155
138 3300000062 IMNBL1DRAFT_c0052768 IMNBL1DRAFT_00527681 156
139 3300000062 IMNBL1DRAFT_c0122553 IMNBL1DRAFT_01225532 156
140 3300002449 JGI24698J34947_10099381 JGI24698J34947_100993812 156
141 3300002450 JGI24695J34938_10087999 JGI24695J34938_100879992 156
142 3300002450 JGI24695J34938_10186034 JGI24695J34938_101860342 156
143 3300002462 JGI24702J35022_10082359 JGI24702J35022_100823592 156
144 3300002462 JGI24702J35022_10181558 JGI24702J35022_101815582 156
145 3300002504 JGI24705J35276_12165015 JGI24705J35276_121650151 156
146 3300002834 JGI24696J40584_12439764 JGI24696J40584_124397641 156
147 3300002834 JGI24696J40584_12915788 JGI24696J40584_129157882 156
148 3300005083 Ga0068305_11139384 Ga0068305_111393841 156
149 3300005200 Ga0072940_1037094 Ga0072940_10370943 156
150 3300005201 Ga0072941_1033068 Ga0072941_10330681 156
151 3300009784 Ga0123357_10287040 Ga0123357_102870402 156
152 3300009826 Ga0123355_10607718 Ga0123355_106077182 156
153 3300009826 Ga0123355_10745915 Ga0123355_107459152 156
154 3300009826 Ga0123355_10815779 Ga0123355_108157792 156
155 3300010049 Ga0123356_10103005 Ga0123356_101030051 156
156 3300010049 Ga0123356_10181434 Ga0123356_101814343 156
157 3300010049 Ga0123356_10320562 Ga0123356_103205623 156
158 3300010049 Ga0123356_10375453 Ga0123356_103754532 156
159 3300010049 Ga0123356_10378893 Ga0123356_103788933 156
160 3300010049 Ga0123356_10436546 Ga0123356_104365462 156
161 3300010049 Ga0123356_10663777 Ga0123356_106637772 156
162 3300010049 Ga0123356_12462406 Ga0123356_124624062 156
163 3300010167 Ga0123353_10021638 Ga0123353_100216388 156
164 3300010167 Ga0123353_10038381 Ga0123353_100383818 156
165 3300010167 Ga0123353_10383277 Ga0123353_103832772 156
166 3300010167 Ga0123353_10416009 Ga0123353_104160094 156
167 3300010167 Ga0123353_10593656 Ga0123353_105936563 156
168 3300010167 Ga0123353_10613592 Ga0123353_106135922 156
169 3300010167 Ga0123353_10754002 Ga0123353_107540021 156
170 3300010167 Ga0123353_10794592 Ga0123353_107945922 156
171 3300010167 Ga0123353_10860955 Ga0123353_108609552 156
172 3300010167 Ga0123353_10897540 Ga0123353_108975402 156
173 3300010167 Ga0123353_11129165 Ga0123353_111291652 156
174 3300010167 Ga0123353_11134864 Ga0123353_111348642 156
175 3300010167 Ga0123353_11182722 Ga0123353_111827222 156
176 3300010167 Ga0123353_11633235 Ga0123353_116332352 156
177 3300010167 Ga0123353_11898700 Ga0123353_118987001 156
178 3300010167 Ga0123353_13379800 Ga0123353_133798001 156
179 3300010882 Ga0123354_10264088 Ga0123354_102640882 156
180 3300010882 Ga0123354_10305477 Ga0123354_103054773 156
181 3300010882 Ga0123354_10321860 Ga0123354_103218602 156
182 3300010882 Ga0123354_10434248 Ga0123354_104342482 156
183 3300010882 Ga0123354_10519435 Ga0123354_105194352 156
184 3300010882 Ga0123354_10824220 Ga0123354_108242201 156
185 3300042592 Ga0466693_353858 Ga0466693_353858_902_1372 156
186 3300042592 Ga0466693_396594 Ga0466693_396594_110_580 156
187 3300002450 JGI24695J34938_10082384 JGI24695J34938_100823841 157
188 3300042595 Ga0466695_147505 Ga0466695_147505_380_856 158
189 3300042624 Ga0466735_148626 Ga0466735_148626_106_582 158
190 3300042605 Ga0466716_536974 Ga0466716_536974_2188_2670 160
191 3300009826 Ga0123355_10634093 Ga0123355_106340932 161
192 3300042604 Ga0466717_000329 Ga0466717_000329_483_974 163
193 3300010049 Ga0123356_12482403 Ga0123356_124824031 165
194 3300042612 Ga0466705_009070 Ga0466705_009070_10722_11219 165
195 3300010167 Ga0123353_10489049 Ga0123353_104890493 167
196 3300042636 Ga0466703_236726 Ga0466703_236726_759_1265 168
197 3300042597 Ga0466699_373595 Ga0466699_373595_977_1486 169
198 3300042599 Ga0466706_113222 Ga0466706_113222_385_894 169
199 iso_pr_bacteria 2820217359 2820218721 169
200 3300042655 Ga0466727_092060 Ga0466727_092060_116_628 170
201 3300010049 Ga0123356_11223388 Ga0123356_112233882 175
202 3300009826 Ga0123355_10507139 Ga0123355_105071392 179
203 3300010882 Ga0123354_10236796 Ga0123354_102367962 179

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13551 HTH_29 Winged helix-turn helix 57 126 0.92
PF13565 HTH_32 Homeodomain-like domain 88 170 0.77

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.55 0.66 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.