Protein Family IF02560
Metagenome
Metatranscriptome
Isolate
306
Members
146
Samples
217
Scaffolds
93.08
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10485768|Ga0123355_104857682
- Length
- 102 aa
- Sequence
- MARSTKKGPFIDKHLMVKIEDMNTRNEKKVVRTWSRRSTVVPEMVGHTLAVHNGKKFIPVYVTENMVGHKLGEFSLTRSFKGHSVKAATEAAAKPAPVPAR*
Sample Types
Isolate
29.1%
Metagenome
69.6%
MAG
0.0%
Metatranscriptome
1.3%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
53.1%
Termitidae
19.6%
Kalotermitidae
9.8%
Unclassified
7.7%
Rhinotermitidae
2.8%
Termopsidae
2.8%
Berytidae
1.4%
Hodotermitidae
0.7%
Tenebrionidae
0.7%
Alydidae
0.7%
Passalidae
0.7%
Taxonomy
Archaea
0
Bacteria
261
Eukaryota
0
Viruses
0
Unclassified
45
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 2 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 3 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 4 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 5 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 6 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 7 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 8 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 9 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 10 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 11 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 12 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 13 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 23 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 24 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 25 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 26 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 27 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 28 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 29 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 30 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 31 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 32 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 33 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2820951912 | Unclassified Acidobacteria Emb289P4bin26 | Isolate | Unclassified |
| 38 | 2820004052 | Unclassified Synergistetes Nt197P3bin25 | Isolate | Unclassified |
| 39 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 43 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 44 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 45 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 46 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 47 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 48 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 49 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 50 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 51 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 52 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 53 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 54 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 55 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 56 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 57 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 58 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 59 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 60 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 61 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 62 | 2820183396 | Unclassified Planctomycetes Lab288P3bin214 | Isolate | Unclassified |
| 63 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 64 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 65 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 66 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 67 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 68 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 69 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 70 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 71 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 72 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 73 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 74 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 75 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 76 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 77 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 78 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 79 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 80 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 81 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 82 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 83 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 84 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 85 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 86 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 87 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 88 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 89 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 90 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 91 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 92 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 93 | 2820193510 | Unclassified Planctomycetes Emb289P3bin83 | Isolate | Unclassified |
| 94 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 95 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 96 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 97 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 98 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 99 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 100 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 101 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 102 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 103 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 104 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 105 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 106 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 107 | 2820189034 | Unclassified Planctomycetes Emb289P4bin17 | Isolate | Unclassified |
| 108 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 109 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 110 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 111 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 112 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 113 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 114 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 115 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 116 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 117 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 118 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 119 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 120 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 121 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 122 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 123 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 124 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 125 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 126 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 127 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 128 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 129 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 130 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 131 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 132 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 133 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 134 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 135 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 136 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 137 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 138 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 139 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 140 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 141 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 142 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 143 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 144 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 145 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 146 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_208486 | 3300042612 | Bacteria | 71494 |
| 2 | Ga0466705_211457 | 3300042612 | Bacteria | 22546 |
| 3 | Ga0123357_10098916 | 3300009784 | Unclassified | 3769 |
| 4 | Ga0123357_11030900 | 3300009784 | Bacteria | 507 |
| 5 | Ga0123355_10025592 | 3300009826 | Bacteria | 9504 |
| 6 | Ga0123353_10003864 | 3300010167 | Unclassified | 19122 |
| 7 | Ga0123353_10186932 | 3300010167 | Bacteria | 3275 |
| 8 | Ga0123353_11734182 | 3300010167 | Unclassified | 780 |
| 9 | Ga0123353_12072984 | 3300010167 | Unclassified | 694 |
| 10 | Ga0466711_244087 | 3300042615 | Bacteria | 1079 |
| 11 | Ga0466723_047374 | 3300042618 | Bacteria | 1949 |
| 12 | Ga0466723_058688 | 3300042618 | Bacteria | 13211 |
| 13 | Ga0466723_091919 | 3300042618 | Bacteria | 27263 |
| 14 | Ga0466726_321173 | 3300042619 | Bacteria | 2303 |
| 15 | Ga0466728_259804 | 3300042620 | Bacteria | 5391 |
| 16 | Ga0466729_129641 | 3300042621 | Bacteria | 24606 |
| 17 | Ga0466700_086934 | 3300042600 | Bacteria | 5684 |
| 18 | Ga0466700_213575 | 3300042600 | Unclassified | 1281 |
| 19 | Ga0466700_340779 | 3300042600 | Unclassified | 1433 |
| 20 | Ga0466707_346808 | 3300042601 | Bacteria | 1461 |
| 21 | Ga0466707_370302 | 3300042601 | Bacteria | 16136 |
| 22 | Ga0466716_210817 | 3300042605 | Bacteria | 3764 |
| 23 | Ga0466698_296992 | 3300042610 | Unclassified | 1496 |
| 24 | Ga0466690_029087 | 3300042590 | Bacteria | 68822 |
| 25 | Ga0466696_001041 | 3300042596 | Bacteria | 5090 |
| 26 | Ga0466708_169016 | 3300042652 | Unclassified | 5452 |
| 27 | Ga0466725_212234 | 3300042654 | Bacteria | 1178 |
| 28 | Ga0466727_323814 | 3300042655 | Bacteria | 11712 |
| 29 | Ga0466697_260471 | 3300042611 | Bacteria | 8415 |
| 30 | Ga0466705_053404 | 3300042612 | Bacteria | 5385 |
| 31 | Ga0466733_067145 | 3300042659 | Bacteria | 1129 |
| 32 | Ga0123357_10049693 | 3300009784 | Bacteria | 5680 |
| 33 | Ga0123356_12196150 | 3300010049 | Bacteria | 690 |
| 34 | Ga0123353_10175415 | 3300010167 | Bacteria | 3399 |
| 35 | Ga0123353_10461734 | 3300010167 | Bacteria | 1866 |
| 36 | Ga0123353_10878312 | 3300010167 | Unclassified | 1224 |
| 37 | Ga0123353_13155361 | 3300010167 | Unclassified | 529 |
| 38 | Ga0466711_134125 | 3300042615 | Bacteria | 100014 |
| 39 | Ga0466715_402109 | 3300042616 | Bacteria | 22027 |
| 40 | Ga0466715_439980 | 3300042616 | Bacteria | 6902 |
| 41 | Ga0466723_025288 | 3300042618 | Bacteria | 10411 |
| 42 | Ga0466723_180228 | 3300042618 | Bacteria | 22722 |
| 43 | Ga0466728_355312 | 3300042620 | Bacteria | 41370 |
| 44 | Ga0466706_037575 | 3300042599 | Bacteria | 87054 |
| 45 | Ga0466700_137541 | 3300042600 | Unclassified | 1427 |
| 46 | Ga0466700_277108 | 3300042600 | Bacteria | 1253 |
| 47 | Ga0466707_063131 | 3300042601 | Bacteria | 29958 |
| 48 | Ga0466714_011509 | 3300042603 | Bacteria | 5494 |
| 49 | Ga0466717_084432 | 3300042604 | Unclassified | 1715 |
| 50 | Ga0466716_210754 | 3300042605 | Bacteria | 5513 |
| 51 | Ga0466719_446978 | 3300042606 | Bacteria | 1306 |
| 52 | Ga0466692_164931 | 3300042591 | Bacteria | 1442 |
| 53 | Ga0466693_302096 | 3300042592 | Bacteria | 1677 |
| 54 | Ga0466691_196684 | 3300042593 | Unclassified | 4139 |
| 55 | Ga0466695_330258 | 3300042595 | Bacteria | 8795 |
| 56 | 2227531502 | 2225789004 | Bacteria | 631 |
| 57 | Ga0072941_1293190 | 3300005201 | Bacteria | 2196 |
| 58 | Ga0466703_296215 | 3300042636 | Bacteria | 15840 |
| 59 | Ga0466708_114924 | 3300042652 | Bacteria | 17924 |
| 60 | Ga0123355_10006138 | 3300009826 | Bacteria | 17728 |
| 61 | Ga0123355_10485768 | 3300009826 | Bacteria | 1533 |
| 62 | Ga0123355_11717005 | 3300009826 | Bacteria | 597 |
| 63 | Ga0123356_10030441 | 3300010049 | Bacteria | 5051 |
| 64 | Ga0123356_11895619 | 3300010049 | Unclassified | 742 |
| 65 | Ga0466711_215189 | 3300042615 | Bacteria | 54014 |
| 66 | Ga0466711_376431 | 3300042615 | Bacteria | 48940 |
| 67 | Ga0466715_046636 | 3300042616 | Bacteria | 70768 |
| 68 | Ga0466726_376545 | 3300042619 | Unclassified | 1497 |
| 69 | Ga0466706_076509 | 3300042599 | Bacteria | 7498 |
| 70 | Ga0466706_165715 | 3300042599 | Bacteria | 1067 |
| 71 | Ga0255786_1027431 | 3300022815 | Unclassified | 552 |
| 72 | Ga0456237_0003808 | 3300041968 | Bacteria | 2434 |
| 73 | Ga0466690_197286 | 3300042590 | Bacteria | 16554 |
| 74 | Ga0466693_133610 | 3300042592 | Unclassified | 1577 |
| 75 | Ga0466691_226264 | 3300042593 | Bacteria | 41880 |
| 76 | Ga0466694_038884 | 3300042594 | Bacteria | 1872 |
| 77 | Ga0466696_199358 | 3300042596 | Bacteria | 7259 |
| 78 | Ga0068302_10018491 | 3300005071 | Bacteria | 6616 |
| 79 | Ga0105524_108403 | 3300007733 | Bacteria | 1232 |
| 80 | Ga0466734_031729 | 3300042623 | Bacteria | 1420 |
| 81 | Ga0466734_060641 | 3300042623 | Unclassified | 1182 |
| 82 | Ga0466735_002351 | 3300042624 | Bacteria | 3609 |
| 83 | Ga0466704_591830 | 3300042643 | Bacteria | 37928 |
| 84 | Ga0466725_456419 | 3300042654 | Bacteria | 1380 |
| 85 | Ga0466727_322139 | 3300042655 | Bacteria | 101886 |
| 86 | Ga0123355_10686681 | 3300009826 | Bacteria | 1181 |
| 87 | Ga0123356_10006430 | 3300010049 | Bacteria | 11843 |
| 88 | Ga0123353_11675949 | 3300010167 | Unclassified | 798 |
| 89 | Ga0123353_13346806 | 3300010167 | Bacteria | 510 |
| 90 | Ga0466729_053410 | 3300042621 | Bacteria | 50114 |
| 91 | Ga0466700_316540 | 3300042600 | Bacteria | 1216 |
| 92 | Ga0466707_072057 | 3300042601 | Bacteria | 3714 |
| 93 | Ga0466717_246157 | 3300042604 | Bacteria | 1351 |
| 94 | Ga0466719_412244 | 3300042606 | Unclassified | 2144 |
| 95 | Ga0255809_1026201 | 3300022820 | Bacteria | 858 |
| 96 | Ga0466690_262559 | 3300042590 | Bacteria | 16410 |
| 97 | Ga0466692_188422 | 3300042591 | Unclassified | 1683 |
| 98 | Ga0466695_332407 | 3300042595 | Bacteria | 1793 |
| 99 | JGI24702J35022_10006433 | 3300002462 | Bacteria | 6791 |
| 100 | JGI24705J35276_12164927 | 3300002504 | Unclassified | 1255 |
| 101 | Ga0068302_10000447 | 3300005071 | Bacteria | 13341 |
| 102 | Ga0068305_10005517 | 3300005083 | Bacteria | 12275 |
| 103 | Ga0466734_148070 | 3300042623 | Unclassified | 1027 |
| 104 | Ga0466735_172430 | 3300042624 | Bacteria | 13043 |
| 105 | Ga0466704_375586 | 3300042643 | Bacteria | 37503 |
| 106 | Ga0466708_367220 | 3300042652 | Bacteria | 13976 |
| 107 | Ga0466727_214209 | 3300042655 | Bacteria | 66628 |
| 108 | Ga0466697_100815 | 3300042611 | Unclassified | 3712 |
| 109 | Ga0123355_10255335 | 3300009826 | Bacteria | 2461 |
| 110 | Ga0123355_10727227 | 3300009826 | Bacteria | 1130 |
| 111 | Ga0123356_12302574 | 3300010049 | Unclassified | 674 |
| 112 | Ga0123353_10000161 | 3300010167 | Bacteria | 85161 |
| 113 | Ga0123353_10000836 | 3300010167 | Bacteria | 37407 |
| 114 | Ga0123354_10371801 | 3300010882 | Unclassified | 1246 |
| 115 | Ga0466723_085453 | 3300042618 | Bacteria | 73497 |
| 116 | Ga0466701_019610 | 3300042598 | Bacteria | 11080 |
| 117 | Ga0466707_328912 | 3300042601 | Bacteria | 2651 |
| 118 | Ga0466714_015031 | 3300042603 | Bacteria | 1304 |
| 119 | Ga0466717_255585 | 3300042604 | Bacteria | 1832 |
| 120 | Ga0466719_048950 | 3300042606 | Bacteria | 50096 |
| 121 | Ga0466719_402018 | 3300042606 | Bacteria | 1300 |
| 122 | Ga0466719_508499 | 3300042606 | Unclassified | 3115 |
| 123 | Ga0466698_488436 | 3300042610 | Bacteria | 2278 |
| 124 | Ga0255809_1010359 | 3300022820 | Bacteria | 993 |
| 125 | Ga0255809_1018690 | 3300022820 | Bacteria | 1161 |
| 126 | Ga0466690_230957 | 3300042590 | Bacteria | 25729 |
| 127 | JGI24698J34947_10029687 | 3300002449 | Bacteria | 2888 |
| 128 | Ga0068305_10005361 | 3300005083 | Bacteria | 24001 |
| 129 | Ga0466709_233182 | 3300042648 | Bacteria | 91749 |
| 130 | Ga0466708_274375 | 3300042652 | Bacteria | 21022 |
| 131 | Ga0466727_266471 | 3300042655 | Bacteria | 1442 |
| 132 | Ga0466727_271147 | 3300042655 | Bacteria | 176023 |
| 133 | Ga0466697_195588 | 3300042611 | Bacteria | 1737 |
| 134 | Ga0466697_199617 | 3300042611 | Bacteria | 5080 |
| 135 | Ga0466697_243836 | 3300042611 | Unclassified | 2127 |
| 136 | Ga0466705_372069 | 3300042612 | Bacteria | 2696 |
| 137 | Ga0123355_10058472 | 3300009826 | Unclassified | 6236 |
| 138 | Ga0123355_11686343 | 3300009826 | Bacteria | 605 |
| 139 | Ga0123356_10002433 | 3300010049 | Bacteria | 19910 |
| 140 | Ga0123356_10093745 | 3300010049 | Unclassified | 2866 |
| 141 | Ga0123353_10078429 | 3300010167 | Bacteria | 5308 |
| 142 | Ga0123353_10387679 | 3300010167 | Bacteria | 2086 |
| 143 | Ga0466705_455725 | 3300042612 | Bacteria | 1625 |
| 144 | Ga0466712_206654 | 3300042614 | Bacteria | 18028 |
| 145 | Ga0466718_154365 | 3300042617 | Bacteria | 1524 |
| 146 | Ga0466723_181016 | 3300042618 | Bacteria | 1791 |
| 147 | Ga0466723_314377 | 3300042618 | Bacteria | 5189 |
| 148 | Ga0466726_303540 | 3300042619 | Bacteria | 65545 |
| 149 | Ga0466726_387678 | 3300042619 | Bacteria | 397429 |
| 150 | Ga0466728_320012 | 3300042620 | Bacteria | 43671 |
| 151 | Ga0466729_117205 | 3300042621 | Bacteria | 50557 |
| 152 | Ga0466706_110892 | 3300042599 | Bacteria | 1248 |
| 153 | Ga0466707_090475 | 3300042601 | Bacteria | 2365 |
| 154 | Ga0466707_265235 | 3300042601 | Bacteria | 38227 |
| 155 | Ga0466690_119837 | 3300042590 | Unclassified | 1589 |
| 156 | Ga0466690_227494 | 3300042590 | Bacteria | 19382 |
| 157 | Ga0466691_061285 | 3300042593 | Unclassified | 13770 |
| 158 | Ga0466694_184545 | 3300042594 | Unclassified | 2522 |
| 159 | JGI24702J35022_10001245 | 3300002462 | Bacteria | 15858 |
| 160 | Ga0068302_10107774 | 3300005071 | Bacteria | 726 |
| 161 | Ga0466729_226506 | 3300042621 | Bacteria | 10868 |
| 162 | Ga0466729_300007 | 3300042621 | Unclassified | 2821 |
| 163 | Ga0466735_017246 | 3300042624 | Bacteria | 2294 |
| 164 | Ga0466735_070486 | 3300042624 | Bacteria | 4094 |
| 165 | Ga0466697_070203 | 3300042611 | Unclassified | 1271 |
| 166 | Ga0466697_228941 | 3300042611 | Bacteria | 1709 |
| 167 | Ga0466705_365823 | 3300042612 | Bacteria | 22090 |
| 168 | Ga0123357_10738628 | 3300009784 | Unclassified | 689 |
| 169 | Ga0123355_10074369 | 3300009826 | Unclassified | 5443 |
| 170 | Ga0123355_10379682 | 3300009826 | Unclassified | 1843 |
| 171 | Ga0123356_10024518 | 3300010049 | Bacteria | 5674 |
| 172 | Ga0123356_10861816 | 3300010049 | Unclassified | 1077 |
| 173 | Ga0123353_11681543 | 3300010167 | Bacteria | 796 |
| 174 | Ga0123353_11728400 | 3300010167 | Bacteria | 782 |
| 175 | Ga0123354_10686028 | 3300010882 | Bacteria | 720 |
| 176 | Ga0466712_105311 | 3300042614 | Bacteria | 19617 |
| 177 | Ga0466723_280786 | 3300042618 | Bacteria | 6535 |
| 178 | Ga0466726_322651 | 3300042619 | Bacteria | 2396 |
| 179 | Ga0466720_125334 | 3300042607 | Bacteria | 1093 |
| 180 | Ga0160452_100151 | 3300012834 | Bacteria | 81696 |
| 181 | Ga0466690_036158 | 3300042590 | Bacteria | 54519 |
| 182 | JGI24702J35022_10822138 | 3300002462 | Bacteria | 579 |
| 183 | Ga0466730_048382 | 3300042625 | Bacteria | 2390 |
| 184 | Ga0466704_027024 | 3300042643 | Bacteria | 2435 |
| 185 | Ga0466704_177682 | 3300042643 | Bacteria | 28567 |
| 186 | Ga0466727_164672 | 3300042655 | Bacteria | 1738 |
| 187 | Ga0466697_120351 | 3300042611 | Bacteria | 4841 |
| 188 | Ga0562377_1712 | 3300056842 | Bacteria | 20591 |
| 189 | Ga0123357_10271636 | 3300009784 | Unclassified | 1770 |
| 190 | Ga0123355_11097690 | 3300009826 | Bacteria | 828 |
| 191 | Ga0123355_11228852 | 3300009826 | Bacteria | 761 |
| 192 | Ga0123353_10514454 | 3300010167 | Bacteria | 1739 |
| 193 | Ga0123353_10562316 | 3300010167 | Unclassified | 1642 |
| 194 | Ga0123353_11624954 | 3300010167 | Bacteria | 814 |
| 195 | Ga0123354_11012353 | 3300010882 | Bacteria | 534 |
| 196 | Ga0466705_419512 | 3300042612 | Bacteria | 1317 |
| 197 | Ga0466712_270258 | 3300042614 | Bacteria | 2228 |
| 198 | Ga0466715_419227 | 3300042616 | Unclassified | 1568 |
| 199 | Ga0466715_569171 | 3300042616 | Bacteria | 16286 |
| 200 | Ga0466723_222901 | 3300042618 | Bacteria | 1009 |
| 201 | Ga0466723_275356 | 3300042618 | Bacteria | 7307 |
| 202 | Ga0466728_151666 | 3300042620 | Bacteria | 23701 |
| 203 | Ga0466706_159342 | 3300042599 | Bacteria | 4293 |
| 204 | Ga0466716_126380 | 3300042605 | Bacteria | 28858 |
| 205 | Ga0466719_152619 | 3300042606 | Bacteria | 6002 |
| 206 | Ga0466719_492562 | 3300042606 | Bacteria | 22587 |
| 207 | Ga0466722_098255 | 3300042609 | Bacteria | 7368 |
| 208 | Ga0466722_188234 | 3300042609 | Bacteria | 7645 |
| 209 | Ga0466693_085001 | 3300042592 | Unclassified | 1358 |
| 210 | Ga0466695_061074 | 3300042595 | Bacteria | 1223 |
| 211 | Ga0072940_1181430 | 3300005200 | Bacteria | 556 |
| 212 | Ga0072941_1213394 | 3300005201 | Unclassified | 2208 |
| 213 | Ga0466731_170859 | 3300042622 | Bacteria | 1969 |
| 214 | Ga0466734_158812 | 3300042623 | Bacteria | 13514 |
| 215 | Ga0466735_074658 | 3300042624 | Bacteria | 4319 |
| 216 | Ga0466725_126764 | 3300042654 | Unclassified | 1204 |
| 217 | Ga0466727_208576 | 3300042655 | Bacteria | 3505 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00203 | Ribosomal_S19 | Ribosomal protein S19 | 3 | 83 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.