Protein Family IF02511
Metagenome
Metatranscriptome
Isolate
334
Members
147
Samples
230
Scaffolds
426.72
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10252007|Ga0123355_102520073
- Length
- 473 aa
- Sequence
- MRPKHKRLGTAQKRMAQGAERHYFWRRSLYIFHYIKERRRTDCMRLELGMIHIKNVQFADKTEVKSGTLFVNKDELAKAAAGDDDRVKSVEVFLARPGESVRILPVKDVVEPRVKVEGPGGIFPGFTANVDQVGSGKTHVLKGAAVVTTGKIVGFQEGIIDMSGPGAEYTPFSKTYNVVVKVEPLDEIKQHDHEVVVRMAGLRAANYLGLAGKDVTPDDVKVYETKPLMQQIMQYTHLPKVAYVYMLQTQGLLHNTFYYGVNVSEIVPTFMYPTEVMDGAIISGNCVSACDKNPTYIHANSPVIEELYKEHGKTINFLGCIITNENVTLEDKERSSNMTAKLVEFLGPDAVIISEEGFGNPDADLVMNCNKIEKLGIKTVLITDEYAGQDGASQSLADSTPLGDACVTAGNANEVITLPKMDTVIGYPETANVIAGAWDGSLNADGSITAEIQVIISATNELGYGYLSAKTI*
Sample Types
Isolate
31.1%
Metagenome
66.2%
MAG
0.0%
Metatranscriptome
2.7%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
49.7%
Termitidae
21.4%
Blattidae
9.7%
Kalotermitidae
6.9%
Tenebrionidae
2.8%
Scarabaeidae
1.4%
Stratiomyidae
1.4%
Passalidae
1.4%
Termopsidae
1.4%
Rhinotermitidae
0.7%
Rhopalidae
0.7%
Hydrophilidae
0.7%
Hodotermitidae
0.7%
Dytiscidae
0.7%
Majidae
0.7%
Taxonomy
Archaea
0
Bacteria
320
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 2 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 3 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 4 | 2820422691 | Unclassified Firmicutes Lab288P3bin58 | Isolate | Unclassified |
| 5 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 6 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 7 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 8 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 9 | 2820669764 | Unclassified Firmicutes Co191P3bin30 | Isolate | Unclassified |
| 10 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 11 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 12 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 21 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 22 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 23 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 24 | 2820526825 | Unclassified Firmicutes Lab288P1bin16 | Isolate | Unclassified |
| 25 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 26 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 27 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 28 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 29 | 2758568796 | Unclassified Deltaproteobacteria Th196P3_bin21 | Isolate | Unclassified |
| 30 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 31 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 32 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 33 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 34 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 37 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 38 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 39 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 40 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 41 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 42 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 43 | 2820426531 | Unclassified Firmicutes Lab288P3bin45 | Isolate | Unclassified |
| 44 | 2820459456 | Unclassified Firmicutes Lab288P3bin148 | Isolate | Unclassified |
| 45 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 46 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 47 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 48 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 49 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 50 | 2820681712 | Unclassified Firmicutes Co191P1bin84 | Isolate | Unclassified |
| 51 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 52 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 53 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 54 | 2820004052 | Unclassified Synergistetes Nt197P3bin25 | Isolate | Unclassified |
| 55 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 56 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 57 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 58 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 59 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 60 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 61 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 62 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 63 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 64 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 65 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 66 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 67 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 68 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 69 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 70 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 71 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 72 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 73 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 74 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 75 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 76 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 77 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 78 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 79 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 80 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 81 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 82 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 83 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 84 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 85 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 86 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 87 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 88 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 89 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 90 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 91 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 92 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 93 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 94 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 95 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 96 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 97 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 98 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 99 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 100 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 101 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 102 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 103 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 104 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 105 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 106 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 107 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 108 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 109 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 110 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 111 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 112 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 113 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 114 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 115 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 116 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 117 | 2820323050 | Unclassified Firmicutes Nt197P3bin84 | Isolate | Unclassified |
| 118 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 119 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 120 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 121 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 122 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 123 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 124 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 125 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 126 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 127 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 128 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 129 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 130 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 131 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 132 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 133 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 134 | 2820545146 | Unclassified Firmicutes Lab288P1bin104 | Isolate | Unclassified |
| 135 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 136 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 137 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 138 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 139 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 140 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 141 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 142 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 143 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 144 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 145 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 146 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 147 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_071603 | 3300042611 | Bacteria | 3744 |
| 2 | Ga0123355_10003248 | 3300009826 | Bacteria | 23236 |
| 3 | Ga0123355_10005491 | 3300009826 | Bacteria | 18585 |
| 4 | Ga0123355_10007346 | 3300009826 | Bacteria | 16501 |
| 5 | Ga0123355_10047071 | 3300009826 | Bacteria | 7013 |
| 6 | Ga0123355_10248370 | 3300009826 | Bacteria | 2509 |
| 7 | Ga0123356_10001890 | 3300010049 | Bacteria | 22704 |
| 8 | Ga0123356_10006057 | 3300010049 | Bacteria | 12267 |
| 9 | Ga0123356_10020112 | 3300010049 | Bacteria | 6323 |
| 10 | Ga0123356_10120330 | 3300010049 | Bacteria | 2552 |
| 11 | Ga0123356_10181575 | 3300010049 | Bacteria | 2126 |
| 12 | Ga0123356_10378860 | 3300010049 | Bacteria | 1547 |
| 13 | Ga0123353_10000078 | 3300010167 | Bacteria | 107269 |
| 14 | Ga0123353_10097396 | 3300010167 | Bacteria | 4741 |
| 15 | Ga0123353_10207699 | 3300010167 | Bacteria | 3074 |
| 16 | Ga0123353_10465570 | 3300010167 | Unclassified | 1855 |
| 17 | Ga0123354_10282837 | 3300010882 | Bacteria | 1607 |
| 18 | Ga0466707_169398 | 3300042601 | Bacteria | 3990 |
| 19 | Ga0466714_108758 | 3300042603 | Bacteria | 16582 |
| 20 | Ga0466721_024061 | 3300042608 | Bacteria | 18917 |
| 21 | Ga0223683_1000600 | 3300021245 | Bacteria | 1836 |
| 22 | Ga0255809_1000462 | 3300022820 | Bacteria | 2401 |
| 23 | Ga0415639_011622 | 3300038395 | Bacteria | 14726 |
| 24 | Ga0415639_019491 | 3300038395 | Bacteria | 6073 |
| 25 | JGI24695J34938_10000151 | 3300002450 | Bacteria | 63482 |
| 26 | JGI24695J34938_10032974 | 3300002450 | Bacteria | 2387 |
| 27 | JGI24702J35022_10029295 | 3300002462 | Bacteria | 2956 |
| 28 | Ga0466724_39856 | 3300042649 | Bacteria | 27534 |
| 29 | Ga0466725_417043 | 3300042654 | Bacteria | 3110 |
| 30 | Ga0123355_10000142 | 3300009826 | Bacteria | 85673 |
| 31 | Ga0123355_10000321 | 3300009826 | Bacteria | 61754 |
| 32 | Ga0123355_10002664 | 3300009826 | Bacteria | 25343 |
| 33 | Ga0123355_10052779 | 3300009826 | Bacteria | 6594 |
| 34 | Ga0123355_10071406 | 3300009826 | Bacteria | 5573 |
| 35 | Ga0123355_10115303 | 3300009826 | Bacteria | 4184 |
| 36 | Ga0123355_10357007 | 3300009826 | Bacteria | 1929 |
| 37 | Ga0123356_10001317 | 3300010049 | Bacteria | 27475 |
| 38 | Ga0123356_10003578 | 3300010049 | Bacteria | 16238 |
| 39 | Ga0123356_10047966 | 3300010049 | Bacteria | 3974 |
| 40 | Ga0123353_10036042 | 3300010167 | Bacteria | 7745 |
| 41 | Ga0123353_10142897 | 3300010167 | Bacteria | 3832 |
| 42 | Ga0123353_10201870 | 3300010167 | Bacteria | 3127 |
| 43 | Ga0123353_10294338 | 3300010167 | Bacteria | 2483 |
| 44 | Ga0466715_303024 | 3300042616 | Bacteria | 9851 |
| 45 | Ga0223683_1005633 | 3300021245 | Bacteria | 2282 |
| 46 | Ga0255809_1008793 | 3300022820 | Bacteria | 2233 |
| 47 | Ga0264413_147828 | 3300024493 | Bacteria | 7857 |
| 48 | Ga0466693_000104 | 3300042592 | Bacteria | 2368 |
| 49 | 2227524619 | 2225789004 | Bacteria | 16986 |
| 50 | JGI24695J34938_10001712 | 3300002450 | Bacteria | 18141 |
| 51 | JGI24695J34938_10008608 | 3300002450 | Bacteria | 5799 |
| 52 | JGI24695J34938_10011985 | 3300002450 | Unclassified | 4626 |
| 53 | JGI24702J35022_10026366 | 3300002462 | Bacteria | 3131 |
| 54 | JGI24705J35276_12237270 | 3300002504 | Bacteria | 10477 |
| 55 | Ga0466731_322900 | 3300042622 | Bacteria | 1743 |
| 56 | Ga0466703_020545 | 3300042636 | Bacteria | 13780 |
| 57 | Ga0466725_037112 | 3300042654 | Bacteria | 17807 |
| 58 | Ga0466732_278804 | 3300042656 | Bacteria | 10504 |
| 59 | Ga0123355_10001355 | 3300009826 | Bacteria | 34038 |
| 60 | Ga0123355_10005865 | 3300009826 | Bacteria | 18076 |
| 61 | Ga0123355_10034009 | 3300009826 | Bacteria | 8279 |
| 62 | Ga0123355_10252007 | 3300009826 | Bacteria | 2483 |
| 63 | Ga0123356_10015129 | 3300010049 | Bacteria | 7399 |
| 64 | Ga0123356_10018634 | 3300010049 | Bacteria | 6587 |
| 65 | Ga0123356_10040480 | 3300010049 | Bacteria | 4342 |
| 66 | Ga0123356_10138584 | 3300010049 | Bacteria | 2397 |
| 67 | Ga0123353_10058085 | 3300010167 | Bacteria | 6198 |
| 68 | Ga0123353_10178093 | 3300010167 | Bacteria | 3369 |
| 69 | Ga0123353_10240118 | 3300010167 | Bacteria | 2816 |
| 70 | Ga0123353_10412009 | 3300010167 | Bacteria | 2006 |
| 71 | Ga0123354_10098179 | 3300010882 | Bacteria | 3985 |
| 72 | Ga0466706_019772 | 3300042599 | Bacteria | 18347 |
| 73 | Ga0466706_247371 | 3300042599 | Bacteria | 2914 |
| 74 | Ga0466721_015559 | 3300042608 | Bacteria | 5050 |
| 75 | Ga0466711_092631 | 3300042615 | Bacteria | 17105 |
| 76 | Ga0255786_1004998 | 3300022815 | Bacteria | 3604 |
| 77 | Ga0466693_060342 | 3300042592 | Bacteria | 4194 |
| 78 | Ga0466693_072262 | 3300042592 | Bacteria | 6019 |
| 79 | JGI24695J34938_10009611 | 3300002450 | Bacteria | 5364 |
| 80 | Ga0072941_1404741 | 3300005201 | Bacteria | 2006 |
| 81 | Ga0466733_036420 | 3300042659 | Bacteria | 12541 |
| 82 | Ga0466733_182659 | 3300042659 | Bacteria | 183103 |
| 83 | Ga0530661_016668 | 3300056564 | Bacteria | 2066 |
| 84 | Ga0123355_10001882 | 3300009826 | Bacteria | 29456 |
| 85 | Ga0123355_10070219 | 3300009826 | Bacteria | 5627 |
| 86 | Ga0123355_10098416 | 3300009826 | Unclassified | 4613 |
| 87 | Ga0123355_10212430 | 3300009826 | Unclassified | 2801 |
| 88 | Ga0123356_10000226 | 3300010049 | Bacteria | 65646 |
| 89 | Ga0123356_10002891 | 3300010049 | Bacteria | 18192 |
| 90 | Ga0123356_10026983 | 3300010049 | Bacteria | 5385 |
| 91 | Ga0123356_10035908 | 3300010049 | Bacteria | 4628 |
| 92 | Ga0123356_10059750 | 3300010049 | Bacteria | 3556 |
| 93 | Ga0123356_10140463 | 3300010049 | Bacteria | 2382 |
| 94 | Ga0123353_10004211 | 3300010167 | Bacteria | 18469 |
| 95 | Ga0123353_10229158 | 3300010167 | Bacteria | 2898 |
| 96 | Ga0466713_095526 | 3300042602 | Bacteria | 106941 |
| 97 | Ga0466721_069510 | 3300042608 | Bacteria | 1845 |
| 98 | Ga0466697_025148 | 3300042611 | Bacteria | 1387 |
| 99 | Ga0466712_038107 | 3300042614 | Bacteria | 4051 |
| 100 | Ga0466715_110993 | 3300042616 | Bacteria | 6323 |
| 101 | Ga0466729_075631 | 3300042621 | Bacteria | 3037 |
| 102 | Ga0415639_009365 | 3300038395 | Bacteria | 11420 |
| 103 | Ga0466729_267854 | 3300042621 | Bacteria | 2158 |
| 104 | Ga0466708_296344 | 3300042652 | Bacteria | 42210 |
| 105 | Ga0466705_301455 | 3300042612 | Bacteria | 23726 |
| 106 | Ga0123355_10000911 | 3300009826 | Bacteria | 40921 |
| 107 | Ga0123355_10004100 | 3300009826 | Bacteria | 21124 |
| 108 | Ga0123355_10005257 | 3300009826 | Bacteria | 18906 |
| 109 | Ga0123355_10017343 | 3300009826 | Bacteria | 11377 |
| 110 | Ga0123356_10009784 | 3300010049 | Bacteria | 9450 |
| 111 | Ga0123356_10017775 | 3300010049 | Bacteria | 6756 |
| 112 | Ga0123356_10022362 | 3300010049 | Bacteria | 5971 |
| 113 | Ga0123356_10037243 | 3300010049 | Bacteria | 4539 |
| 114 | Ga0123356_10072459 | 3300010049 | Unclassified | 3237 |
| 115 | Ga0123356_10090839 | 3300010049 | Bacteria | 2909 |
| 116 | Ga0123353_10003265 | 3300010167 | Bacteria | 20469 |
| 117 | Ga0123353_10010227 | 3300010167 | Bacteria | 13056 |
| 118 | Ga0123353_10017084 | 3300010167 | Bacteria | 10641 |
| 119 | Ga0123353_10091623 | 3300010167 | Bacteria | 4896 |
| 120 | Ga0123353_10102374 | 3300010167 | Bacteria | 4616 |
| 121 | Ga0123353_10158217 | 3300010167 | Bacteria | 3609 |
| 122 | Ga0123353_10177116 | 3300010167 | Bacteria | 3380 |
| 123 | Ga0123354_10137459 | 3300010882 | Bacteria | 3046 |
| 124 | Ga0123354_10164404 | 3300010882 | Bacteria | 2616 |
| 125 | Ga0466701_096457 | 3300042598 | Bacteria | 2408 |
| 126 | Ga0466700_120312 | 3300042600 | Bacteria | 2556 |
| 127 | Ga0466710_094596 | 3300042613 | Bacteria | 2215 |
| 128 | Ga0222431_1000856 | 3300021190 | Bacteria | 5160 |
| 129 | Ga0233288_1001228 | 3300022232 | Bacteria | 1546 |
| 130 | IMNBL1DRAFT_c0002568 | 3300000062 | Bacteria | 12508 |
| 131 | JGI24695J34938_10023034 | 3300002450 | Unclassified | 3010 |
| 132 | JGI24703J35330_11748283 | 3300002501 | Bacteria | 13053 |
| 133 | Ga0466725_087547 | 3300042654 | Bacteria | 6089 |
| 134 | Ga0466725_154695 | 3300042654 | Bacteria | 19274 |
| 135 | Ga0466727_347158 | 3300042655 | Bacteria | 5813 |
| 136 | Ga0562379_0156 | 3300056790 | Bacteria | 206058 |
| 137 | Ga0562377_0139 | 3300056842 | Bacteria | 209225 |
| 138 | Ga0123355_10000081 | 3300009826 | Bacteria | 101187 |
| 139 | Ga0123355_10002238 | 3300009826 | Bacteria | 27304 |
| 140 | Ga0123355_10005875 | 3300009826 | Bacteria | 18071 |
| 141 | Ga0123355_10030027 | 3300009826 | Bacteria | 8808 |
| 142 | Ga0123355_10104922 | 3300009826 | Bacteria | 4436 |
| 143 | Ga0123355_10128099 | 3300009826 | Bacteria | 3917 |
| 144 | Ga0123355_10277151 | 3300009826 | Bacteria | 2321 |
| 145 | Ga0123355_10292542 | 3300009826 | Bacteria | 2233 |
| 146 | Ga0123355_10489407 | 3300009826 | Bacteria | 1525 |
| 147 | Ga0123356_10000033 | 3300010049 | Bacteria | 152581 |
| 148 | Ga0123356_10193466 | 3300010049 | Bacteria | 2067 |
| 149 | Ga0123356_10294732 | 3300010049 | Bacteria | 1724 |
| 150 | Ga0123353_10000246 | 3300010167 | Bacteria | 67982 |
| 151 | Ga0123353_10081832 | 3300010167 | Bacteria | 5193 |
| 152 | Ga0123353_10093911 | 3300010167 | Bacteria | 4833 |
| 153 | Ga0123353_10140605 | 3300010167 | Bacteria | 3867 |
| 154 | Ga0123353_10315673 | 3300010167 | Bacteria | 2375 |
| 155 | Ga0123353_10385498 | 3300010167 | Bacteria | 2094 |
| 156 | Ga0123353_10479976 | 3300010167 | Bacteria | 1819 |
| 157 | Ga0466713_113932 | 3300042602 | Bacteria | 26529 |
| 158 | Ga0466719_010998 | 3300042606 | Bacteria | 1505 |
| 159 | Ga0466723_072463 | 3300042618 | Bacteria | 3875 |
| 160 | Ga0466726_386941 | 3300042619 | Bacteria | 3078 |
| 161 | Ga0255809_1008872 | 3300022820 | Bacteria | 2277 |
| 162 | JGI24695J34938_10000462 | 3300002450 | Bacteria | 39529 |
| 163 | JGI24702J35022_10014457 | 3300002462 | Bacteria | 4355 |
| 164 | Ga0072940_1007504 | 3300005200 | Bacteria | 1807 |
| 165 | Ga0466704_082235 | 3300042643 | Bacteria | 7917 |
| 166 | Ga0466705_004862 | 3300042612 | Bacteria | 2312 |
| 167 | Ga0466733_184792 | 3300042659 | Bacteria | 1383 |
| 168 | Ga0123355_10000099 | 3300009826 | Bacteria | 93904 |
| 169 | Ga0123355_10000786 | 3300009826 | Bacteria | 43435 |
| 170 | Ga0123355_10002190 | 3300009826 | Bacteria | 27570 |
| 171 | Ga0123355_10007536 | 3300009826 | Bacteria | 16330 |
| 172 | Ga0123355_10017063 | 3300009826 | Bacteria | 11463 |
| 173 | Ga0123355_10053471 | 3300009826 | Bacteria | 6546 |
| 174 | Ga0123355_10087494 | 3300009826 | Bacteria | 4951 |
| 175 | Ga0123355_10198650 | 3300009826 | Unclassified | 2935 |
| 176 | Ga0123355_10268886 | 3300009826 | Bacteria | 2372 |
| 177 | Ga0123355_10341676 | 3300009826 | Bacteria | 1993 |
| 178 | Ga0123356_10000604 | 3300010049 | Bacteria | 39698 |
| 179 | Ga0123356_10060292 | 3300010049 | Bacteria | 3541 |
| 180 | Ga0123356_10078799 | 3300010049 | Bacteria | 3111 |
| 181 | Ga0123356_10237690 | 3300010049 | Bacteria | 1891 |
| 182 | Ga0123356_10298464 | 3300010049 | Unclassified | 1715 |
| 183 | Ga0466706_262628 | 3300042599 | Bacteria | 2450 |
| 184 | Ga0466713_013935 | 3300042602 | Bacteria | 20840 |
| 185 | Ga0466721_030930 | 3300042608 | Bacteria | 10094 |
| 186 | Ga0466711_435802 | 3300042615 | Bacteria | 15198 |
| 187 | Ga0415639_002705 | 3300038395 | Bacteria | 45823 |
| 188 | Ga0415639_010121 | 3300038395 | Bacteria | 32586 |
| 189 | Ga0415639_014817 | 3300038395 | Bacteria | 2593 |
| 190 | Ga0415639_027520 | 3300038395 | Bacteria | 7388 |
| 191 | Ga0466691_078352 | 3300042593 | Unclassified | 2024 |
| 192 | Ga0466696_468318 | 3300042596 | Bacteria | 1700 |
| 193 | JGI24695J34938_10000076 | 3300002450 | Bacteria | 83483 |
| 194 | JGI24695J34938_10032066 | 3300002450 | Bacteria | 2432 |
| 195 | Ga0466724_18762 | 3300042649 | Bacteria | 6551 |
| 196 | Ga0466725_286109 | 3300042654 | Bacteria | 3042 |
| 197 | Ga0466725_289395 | 3300042654 | Unclassified | 2443 |
| 198 | Ga0466727_216434 | 3300042655 | Bacteria | 3288 |
| 199 | Ga0562375_0069 | 3300056856 | Bacteria | 354339 |
| 200 | Ga0123355_10000008 | 3300009826 | Bacteria | 191875 |
| 201 | Ga0123355_10000594 | 3300009826 | Bacteria | 48837 |
| 202 | Ga0123355_10001526 | 3300009826 | Bacteria | 32316 |
| 203 | Ga0123355_10003385 | 3300009826 | Bacteria | 22828 |
| 204 | Ga0123355_10018417 | 3300009826 | Bacteria | 11074 |
| 205 | Ga0123355_10020499 | 3300009826 | Unclassified | 10560 |
| 206 | Ga0123355_10023652 | 3300009826 | Unclassified | 9869 |
| 207 | Ga0123355_10079288 | 3300009826 | Bacteria | 5245 |
| 208 | Ga0123355_10166239 | 3300009826 | Bacteria | 3310 |
| 209 | Ga0123355_10298088 | 3300009826 | Bacteria | 2202 |
| 210 | Ga0123356_10051834 | 3300010049 | Bacteria | 3817 |
| 211 | Ga0123356_10074200 | 3300010049 | Bacteria | 3200 |
| 212 | Ga0123356_10081052 | 3300010049 | Bacteria | 3069 |
| 213 | Ga0123356_10097754 | 3300010049 | Bacteria | 2810 |
| 214 | Ga0123356_10265788 | 3300010049 | Unclassified | 1802 |
| 215 | Ga0123353_10003183 | 3300010167 | Bacteria | 20660 |
| 216 | Ga0123353_10064972 | 3300010167 | Bacteria | 5857 |
| 217 | Ga0123353_10121925 | 3300010167 | Bacteria | 4191 |
| 218 | Ga0123353_10127326 | 3300010167 | Bacteria | 4091 |
| 219 | Ga0123353_10200961 | 3300010167 | Bacteria | 3136 |
| 220 | Ga0123354_10024994 | 3300010882 | Unclassified | 9419 |
| 221 | Ga0466707_159669 | 3300042601 | Bacteria | 505639 |
| 222 | Ga0466697_030857 | 3300042611 | Bacteria | 2477 |
| 223 | Ga0255786_1005810 | 3300022815 | Bacteria | 3251 |
| 224 | JGI24698J34947_10014144 | 3300002449 | Bacteria | 4347 |
| 225 | Ga0072941_1026119 | 3300005201 | Bacteria | 14152 |
| 226 | Ga0466730_058005 | 3300042625 | Bacteria | 15510 |
| 227 | Ga0466704_486561 | 3300042643 | Bacteria | 8850 |
| 228 | Ga0466708_303836 | 3300042652 | Bacteria | 6336 |
| 229 | Ga0466725_075225 | 3300042654 | Bacteria | 8552 |
| 230 | Ga0466725_223295 | 3300042654 | Bacteria | 6261 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09338 | Gly_reductase | Glycine/sarcosine/betaine reductase component B subunits | 44 | 470 | 0.99 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF09338 | GO:0050485 | oxidoreductase activity, acting on X-H and Y-H to form an X-Y bond, with a disulfide as acceptor | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.