Protein Family IF02506

Metagenome Isolate
200 Members
111 Samples
159 Scaffolds
540.24 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10247627|Ga0123355_102476272
Length
588 aa
Sequence
MNDTKQKQLGVTLWNIADKLRGAMNADDFRDYMLSFLFLRYLSDNYEDSAKKFLGDEYLECERYIEANMLSDKTEVGSDKPADNIPYFNIEQAAKSLLLRDEDSTDTQLLTPLSVWYTQNSDDIVMFEKEMRRNNHYVIKPDYLWSNISELARTQSGELLKTLQKGFRFIENESFESAFQGLFSEVNLDSEKLGKNYETRNAMLCSIISELTKGLAEFCNENDLLGNAYEYLIGQFAAGSGKKAGEFYTPQQASSILSRIVILDSHDPSAGNNPXXXXGKRDHINNLLDFACGSGSLLIKVRDHLLPEQIGKIYGQEKNITTYNLARMNMLLHGFKVSEFEIFHGDSLSNDWNILNEMNPAKKLECDAVVANPPFSYRWTPSETLSEDFRFKSHGVAPKSAADFAFLLHGFHYLSDKGTMAIILPHGVLFRGGAEEKIRTKLLKDGNIDAVIGLPANLFFSTSIPVCILVLKKCKRPDDVLFINASEYFERGKRQNILLQEHIDKIVDTYQYRREDDKKYSRRVLMDEIEKNGYNLNISRYVSTSVEEEIVDLATVKVDLDRIEYDISNAKARHNQFLRELGLPELP*

📊 Sample Types

Isolate 20.5%
Metagenome 79.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 23.9%
Unclassified 17.4%
Formicidae 13.8%
Kalotermitidae 12.8%
Blattidae 6.4%
Culicidae 4.6%
Elmidae 3.7%
Drosophilidae 2.8%
Apidae 2.8%
Passalidae 2.8%
Hydrophilidae 1.8%
Rhinotermitidae 1.8%
Scarabaeidae 0.9%
Curculionidae 0.9%
Termopsidae 0.9%
Tenebrionidae 0.9%
Hodotermitidae 0.9%
Pteromalidae 0.9%

🌳 Taxonomy

Archaea 1
Bacteria 194
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
2 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
3 2964266314 Entomospira nematocera BR208 Isolate Culicidae
4 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
5 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
13 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
14 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
15 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
16 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
17 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 2850895757 Vibrio campbellii 170502 Isolate Unclassified
22 2785510743 Apibacter sp. ESL0404 Isolate Apidae
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
25 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
26 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
27 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
28 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
29 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
30 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
31 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
32 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
33 2864836148 Arcicella rosea S00070 Isolate Elmidae
34 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
35 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
36 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
37 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
38 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
41 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
42 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
43 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
44 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
45 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
46 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
47 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
48 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
49 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
50 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
51 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
52 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
53 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
54 2882250448 Bizionia sp. APA-3 Isolate
55 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
56 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
57 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
58 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
59 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
60 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
61 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
62 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
63 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
64 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
65 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
66 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
67 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
68 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
69 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
70 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
71 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
72 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
73 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
74 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
75 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
76 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
77 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
78 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
79 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
80 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
81 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
82 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
83 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
84 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
85 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
86 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
87 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
88 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
89 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
90 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
91 2603880165 Burkholderiales A1 Isolate Unclassified
92 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
93 8063589291 Entomospira nematocera BR208 Isolate Culicidae
94 3004667792 Bacteroides sp. 519 Isolate Blattidae
95 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
96 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
97 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
98 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
99 2832298047 Apibacter sp. wkB309 Isolate Apidae
100 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
101 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
102 2820159668 Unclassified Proteobacteria Cu122P3bin5 Isolate Unclassified
103 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
104 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
105 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
106 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
107 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
108 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
109 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
110 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
111 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_187610 3300042611 Bacteria 10215
2 Ga0466732_242870 3300042656 Bacteria 97652
3 Ga0415639_133000 3300038395 Bacteria 2839
4 Ga0466691_110329 3300042593 Bacteria 11349
5 Ga0466691_199124 3300042593 Bacteria 8930
6 Ga0466711_310021 3300042615 Bacteria 9751
7 Ga0466728_111751 3300042620 Bacteria 9728
8 Ga0466735_051034 3300042624 Bacteria 7833
9 Ga0466730_036583 3300042625 Bacteria 5678
10 Ga0466706_143804 3300042599 Bacteria 3210
11 Ga0466719_276031 3300042606 Bacteria 2892
12 Ga0466722_196873 3300042609 Bacteria 1999
13 2227466314 2225789004 Bacteria 5140
14 JGI24695J34938_10015259 3300002450 Bacteria 3946
15 Ga0072940_1069609 3300005200 Bacteria 7314
16 Ga0102734_1000687 3300007129 Bacteria 11618
17 Ga0466705_222137 3300042612 Bacteria 9155
18 Ga0466693_147294 3300042592 Bacteria 3681
19 Ga0466705_451081 3300042612 Bacteria 13817
20 Ga0466728_284441 3300042620 Bacteria 8287
21 Ga0123355_10247627 3300009826 Bacteria 2515
22 Ga0123356_10011835 3300010049 Bacteria 8493
23 Ga0123356_10237135 3300010049 Bacteria 1893
24 Ga0123353_10249582 3300010167 Bacteria 2750
25 Ga0466734_142074 3300042623 Bacteria 3408
26 Ga0466735_061284 3300042624 Bacteria 6910
27 Ga0466730_064130 3300042625 Bacteria 7729
28 Ga0466704_237894 3300042643 Unclassified 10281
29 Ga0466706_037111 3300042599 Bacteria 10424
30 2227303001 2225789004 Bacteria 29616
31 JGI24695J34938_10001310 3300002450 Bacteria 21669
32 JGI24695J34938_10001989 3300002450 Bacteria 16296
33 Ga0103263_100727 3300007042 Bacteria 4482
34 Ga0102736_1000882 3300007052 Bacteria 5902
35 Ga0103266_1000036 3300007067 Bacteria 136459
36 Ga0103266_1000489 3300007067 Bacteria 10771
37 Ga0102735_1001269 3300007080 Bacteria 6400
38 Ga0466705_162485 3300042612 Bacteria 4915
39 Ga0466694_343645 3300042594 Bacteria 2277
40 Ga0466711_001363 3300042615 Bacteria 7083
41 Ga0466728_421585 3300042620 Bacteria 85151
42 Ga0123355_10025408 3300009826 Bacteria 9534
43 Ga0160471_100210 3300012812 Bacteria 20427
44 Ga0466703_033631 3300042636 Bacteria 13045
45 Ga0466704_083555 3300042643 Bacteria 9791
46 Ga0466709_061562 3300042648 Bacteria 14740
47 Ga0466724_17851 3300042649 Bacteria 12578
48 Ga0466724_69112 3300042649 Bacteria 2756
49 Ga0466708_062073 3300042652 Bacteria 36526
50 Ga0466713_006292 3300042602 Bacteria 8412
51 Ga0466721_050053 3300042608 Bacteria 3440
52 JGI24702J35022_10003232 3300002462 Bacteria 9858
53 JGI24702J35022_10017515 3300002462 Bacteria 3913
54 JGI24700J35501_10929089 3300002508 Bacteria 8553
55 Ga0072941_1005047 3300005201 Bacteria 68948
56 Ga0103263_100174 3300007042 Bacteria 10631
57 Ga0123357_10000780 3300009784 Bacteria 32190
58 Ga0466733_059338 3300042659 Bacteria 11566
59 Ga0415639_003189 3300038395 Bacteria 31308
60 Ga0466690_130978 3300042590 Bacteria 9619
61 Ga0466691_171679 3300042593 Bacteria 2775
62 Ga0466695_073735 3300042595 Bacteria 9387
63 Ga0466696_476295 3300042596 Bacteria 1811
64 Ga0466711_329435 3300042615 Bacteria 12131
65 Ga0466723_010097 3300042618 Bacteria 5108
66 Ga0123355_10029878 3300009826 Bacteria 8829
67 Ga0123355_10249012 3300009826 Bacteria 2505
68 Ga0466734_077417 3300042623 Bacteria 3864
69 Ga0466725_166270 3300042654 Bacteria 6192
70 Ga0466714_143060 3300042603 Bacteria 1940
71 IMNBL1DRAFT_c0008725 3300000062 Bacteria 5123
72 Ga0102739_1002042 3300007095 Bacteria 3194
73 Ga0102740_1000006 3300007140 Bacteria 81736
74 Ga0102738_1000124 3300007141 Bacteria 22465
75 Ga0466697_110983 3300042611 Bacteria 1772
76 Ga0466705_316276 3300042612 Bacteria 3173
77 Ga0466733_033179 3300042659 Bacteria 4030
78 Ga0466690_169422 3300042590 Bacteria 39612
79 Ga0466696_201597 3300042596 Bacteria 5625
80 Ga0466715_274802 3300042616 Bacteria 12580
81 Ga0466715_365159 3300042616 Bacteria 12981
82 Ga0123355_10188151 3300009826 Bacteria 3048
83 Ga0123353_10026689 3300010167 Archaea 8831
84 Ga0466731_138772 3300042622 Bacteria 5490
85 Ga0466724_48039 3300042649 Bacteria 20678
86 Ga0466708_199641 3300042652 Bacteria 7983
87 Ga0466708_367292 3300042652 Bacteria 6900
88 Ga0466725_270089 3300042654 Bacteria 33955
89 Ga0466706_041866 3300042599 Bacteria 8860
90 Ga0466706_243039 3300042599 Bacteria 118582
91 Ga0466716_174768 3300042605 Bacteria 4562
92 AustNasuHG_c1015540 3300000089 Unclassified 2567
93 HBC_ctgsDRAFT_1002157 3300000333 Bacteria 4451
94 JGI24698J34947_10037586 3300002449 Bacteria 2514
95 Ga0102735_1000619 3300007080 Bacteria 10500
96 Ga0103264_1003032 3300007188 Bacteria 7671
97 Ga0103267_1000007 3300007190 Bacteria 77495
98 Ga0466690_147994 3300042590 Bacteria 3145
99 Ga0466711_079553 3300042615 Bacteria 2972
100 Ga0466711_194010 3300042615 Bacteria 15427
101 Ga0123356_10059835 3300010049 Bacteria 3553
102 Ga0466709_106644 3300042648 Bacteria 2605
103 Ga0466709_333181 3300042648 Bacteria 1789
104 Ga0466708_115938 3300042652 Unclassified 1695
105 Ga0466706_062541 3300042599 Bacteria 3210
106 Ga0466707_214625 3300042601 Bacteria 7984
107 Ga0466719_287635 3300042606 Bacteria 4759
108 Ga0466722_219399 3300042609 Bacteria 26296
109 HBC_ctgsDRAFT_1007828 3300000333 Bacteria 2524
110 JGI24702J35022_10017919 3300002462 Bacteria 3866
111 Ga0072940_1213565 3300005200 Bacteria 2242
112 Ga0103266_1000010 3300007067 Bacteria 102423
113 Ga0466705_047522 3300042612 Bacteria 12961
114 Ga0466733_114684 3300042659 Bacteria 4778
115 Ga0160447_102725 3300012849 Bacteria 6035
116 Ga0466694_096283 3300042594 Bacteria 4837
117 Ga0466695_253928 3300042595 Bacteria 8530
118 Ga0466711_095278 3300042615 Bacteria 9389
119 Ga0466735_110001 3300042624 Bacteria 2013
120 Ga0466703_078263 3300042636 Bacteria 11583
121 Ga0466709_173991 3300042648 Bacteria 6998
122 Ga0466709_299967 3300042648 Bacteria 10483
123 Ga0466708_030551 3300042652 Bacteria 10203
124 Ga0466725_016500 3300042654 Bacteria 36157
125 Ga0466700_165707 3300042600 Bacteria 3099
126 Ga0466700_380389 3300042600 Unclassified 3851
127 2226999822 2225789003 Bacteria 6176
128 IMNBL1DRAFT_c0004427 3300000062 Bacteria 8462
129 IMNBL1DRAFT_c0004491 3300000062 Bacteria 8355
130 IMNBL1DRAFT_c0016893 3300000062 Bacteria 3100
131 CVPL005W_1000294 3300002934 Bacteria 22286
132 CVPL005L_10000506 3300002938 Bacteria 39509
133 Ga0102739_1000455 3300007095 Bacteria 8380
134 Ga0102738_1002614 3300007141 Bacteria 2682
135 Ga0103267_1004872 3300007190 Bacteria 3706
136 Ga0562374_0048 3300057007 Bacteria 546035
137 Ga0466657_068092 3300042582 Bacteria 157899
138 Ga0466695_372940 3300042595 Bacteria 2988
139 Ga0466696_163213 3300042596 Bacteria 3265
140 Ga0466696_163250 3300042596 Bacteria 6048
141 Ga0466715_225720 3300042616 Bacteria 14185
142 Ga0466728_199551 3300042620 Bacteria 8701
143 Ga0123355_10002617 3300009826 Bacteria 25544
144 Ga0123355_10012571 3300009826 Bacteria 13121
145 Ga0123355_10031799 3300009826 Bacteria 8562
146 Ga0123355_10117348 3300009826 Bacteria 4138
147 Ga0123355_10131596 3300009826 Bacteria 3854
148 Ga0123355_10183832 3300009826 Bacteria 3096
149 Ga0466729_197427 3300042621 Bacteria 17759
150 Ga0466704_507585 3300042643 Bacteria 2299
151 Ga0466724_48921 3300042649 Bacteria 62106
152 JGI24698J34947_10001554 3300002449 Bacteria 12146
153 JGI24698J34947_10002130 3300002449 Bacteria 10593
154 Meta3P_1000891 3300002464 Unclassified 7296
155 Ga0072941_1017138 3300005201 Bacteria 8184
156 Ga0103265_1000217 3300007068 Bacteria 9290
157 Ga0103261_1001466 3300007083 Bacteria 3771
158 Ga0102734_1000193 3300007129 Bacteria 19551
159 Ga0102737_1000439 3300007142 Bacteria 13702

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02384 N6_Mtase N-6 DNA Methylase 221 549 0.95
PF12161 HsdM_N HsdM N-terminal domain 12 210 0.86
PF07669 Eco57I Eco57I restriction-modification methylase 313 454 0.69

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF07669 GO:0006304 DNA modification BP

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.