Protein Family IF02493

Metagenome Isolate
151 Members
49 Samples
146 Scaffolds
263.85 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10219951|Ga0123355_102199513
Length
273 aa
Sequence
MGGDWMSEFMMDRIRENLTALKMKHTLEIIDNYLERAVKDKLNVVEVLDHLLTEEALNKRKRAIETQIMTSGFPMKKELSDFDFSFQPSIDKRQIDELATMRFLENGENIVFLGPPGVGKTHLATALGLAAASHRRSTYYINCHQLIEQLKKAHYENRLPDKLRTLGKYKLLVIDEIGYLPMDIQGANLFFQLIARRYEKVSTIFTSNKTFSQWNEVFADVTIASAILDRVLHHCTVINIKGESYRLKERKEHMKQKQHVINTLFDPALETN*

📊 Sample Types

Isolate 3.3%
Metagenome 96.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 68.1%
Unclassified 12.8%
Kalotermitidae 8.5%
Passalidae 6.4%
Rhinotermitidae 2.1%
Termopsidae 2.1%

🌳 Taxonomy

Archaea 1
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
8 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
9 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
10 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
11 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
12 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
13 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
18 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
23 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
24 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
25 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
26 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
27 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
28 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
29 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
30 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
31 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
32 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
33 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
34 2820080004 Unclassified Proteobacteria Lab288P4bin34 Isolate Unclassified
35 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
36 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
37 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
38 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
39 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
40 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
41 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
42 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
43 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
44 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
45 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
46 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
47 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
48 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
49 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_041216 3300042612 Bacteria 2367
2 Ga0466705_274777 3300042612 Bacteria 2750
3 Ga0265387_1005173 3300024582 Bacteria 1762
4 Ga0415639_032069 3300038395 Bacteria 2294
5 Ga0415639_042645 3300038395 Bacteria 2131
6 Ga0415639_085511 3300038395 Bacteria 2433
7 Ga0466693_345217 3300042592 Bacteria 4366
8 Ga0466693_347942 3300042592 Unclassified 1464
9 Ga0466693_391822 3300042592 Bacteria 2055
10 Ga0466696_221709 3300042596 Bacteria 2577
11 Ga0466696_237332 3300042596 Bacteria 3002
12 Ga0466700_247879 3300042600 Bacteria 3861
13 Ga0466707_196440 3300042601 Bacteria 2906
14 Ga0466714_092934 3300042603 Bacteria 3168
15 Ga0466698_357990 3300042610 Bacteria 1135
16 Ga0123357_10341228 3300009784 Bacteria 1448
17 Ga0123356_10056397 3300010049 Bacteria 3660
18 Ga0123356_10133482 3300010049 Bacteria 2436
19 Ga0123353_11007767 3300010167 Bacteria 1118
20 2227070809 2225789003 Bacteria 2675
21 2227182484 2225789004 Bacteria 1489
22 2227510203 2225789004 Bacteria 3578
23 JGI24695J34938_10048318 3300002450 Unclassified 1874
24 JGI24696J40584_12955790 3300002834 Unclassified 2926
25 Ga0466710_092453 3300042613 Unclassified 2940
26 Ga0466718_063280 3300042617 Bacteria 5869
27 Ga0415639_054131 3300038395 Bacteria 2692
28 Ga0415639_058691 3300038395 Bacteria 1449
29 Ga0466729_316079 3300042621 Bacteria 2338
30 Ga0466735_031148 3300042624 Bacteria 1558
31 Ga0466704_400471 3300042643 Bacteria 1915
32 Ga0466701_060836 3300042598 Unclassified 1646
33 Ga0466720_109270 3300042607 Bacteria 4617
34 Ga0123355_10116081 3300009826 Bacteria 4167
35 Ga0123355_10628273 3300009826 Unclassified 1263
36 Ga0123353_10296886 3300010167 Bacteria 2470
37 Ga0123353_10318360 3300010167 Unclassified 2362
38 Ga0123353_11033382 3300010167 Bacteria 1100
39 Ga0123353_11299198 3300010167 Bacteria 945
40 2227268844 2225789004 Unclassified 1283
41 2227466267 2225789004 Unclassified 966
42 IMNBL1DRAFT_c0068896 3300000062 Bacteria 1029
43 JGI24702J35022_10253905 3300002462 Bacteria 1024
44 JGI24705J35276_12220256 3300002504 Bacteria 2255
45 JGI24696J40584_12923712 3300002834 Bacteria 1379
46 JGI24696J40584_12951607 3300002834 Bacteria 2261
47 Ga0466732_127823 3300042656 Bacteria 2612
48 Ga0265387_1019102 3300024582 Bacteria 1009
49 Ga0466656_007391 3300042550 Bacteria 1229
50 Ga0466656_069799 3300042550 Bacteria 1299
51 Ga0466693_345023 3300042592 Bacteria 2835
52 Ga0466709_362388 3300042648 Bacteria 2282
53 Ga0466700_008978 3300042600 Bacteria 2410
54 Ga0466700_141227 3300042600 Bacteria 3129
55 Ga0123356_10283874 3300010049 Bacteria 1752
56 Ga0123353_10247790 3300010167 Unclassified 2762
57 Ga0123353_10271861 3300010167 Bacteria 2610
58 2227465166 2225789004 Bacteria 977
59 2227606583 2225789004 Bacteria 2293
60 JGI24696J40584_12889885 3300002834 Bacteria 1125
61 Ga0072941_1191741 3300005201 Bacteria 4721
62 Ga0415639_013018 3300038395 Bacteria 1095
63 Ga0415639_020705 3300038395 Bacteria 2169
64 Ga0466656_274264 3300042550 Bacteria 1553
65 Ga0466696_371525 3300042596 Bacteria 2510
66 Ga0466702_236329 3300042635 Bacteria 1513
67 Ga0466725_254467 3300042654 Bacteria 2444
68 Ga0466725_451890 3300042654 Bacteria 3267
69 Ga0466707_019467 3300042601 Archaea 3425
70 Ga0466717_002232 3300042604 Bacteria 2511
71 Ga0466721_197600 3300042608 Bacteria 2865
72 Ga0123355_10219951 3300009826 Bacteria 2733
73 Ga0123355_10982239 3300009826 Bacteria 900
74 Ga0123353_10938236 3300010167 Bacteria 1172
75 IMNBL1DRAFT_c0025423 3300000062 Unclassified 2272
76 JGI24703J35330_11473766 3300002501 Bacteria 1069
77 Ga0466697_109466 3300042611 Bacteria 2600
78 Ga0265387_1023470 3300024582 Bacteria 945
79 Ga0466695_331297 3300042595 Bacteria 2316
80 Ga0466724_36217 3300042649 Bacteria 1074
81 Ga0466700_014891 3300042600 Bacteria 2517
82 Ga0123355_10341261 3300009826 Bacteria 1995
83 Ga0123356_10069058 3300010049 Bacteria 3313
84 Ga0123356_10090472 3300010049 Bacteria 2914
85 Ga0123353_10096422 3300010167 Bacteria 4766
86 JGI24695J34938_10041120 3300002450 Bacteria 2077
87 Ga0265387_1003078 3300024582 Bacteria 2330
88 Ga0415639_052975 3300038395 Bacteria 2274
89 Ga0466693_026390 3300042592 Bacteria 1781
90 Ga0466693_203834 3300042592 Bacteria 1364
91 Ga0466694_125744 3300042594 Bacteria 2370
92 Ga0466699_376958 3300042597 Bacteria 2556
93 Ga0466734_135998 3300042623 Bacteria 2182
94 Ga0466714_168876 3300042603 Bacteria 2609
95 Ga0466721_056945 3300042608 Bacteria 2571
96 Ga0123355_10202907 3300009826 Bacteria 2892
97 Ga0123355_10240615 3300009826 Bacteria 2565
98 Ga0123355_10312022 3300009826 Bacteria 2130
99 Ga0123356_10151348 3300010049 Bacteria 2304
100 Ga0123356_10592381 3300010049 Bacteria 1273
101 Ga0123353_10243688 3300010167 Unclassified 2791
102 Ga0123353_10283049 3300010167 Bacteria 2545
103 Ga0123353_10329600 3300010167 Bacteria 2311
104 Ga0123353_10352939 3300010167 Bacteria 2215
105 Ga0123353_10353553 3300010167 Bacteria 2212
106 Ga0123353_10623683 3300010167 Bacteria 1534
107 Ga0123353_10858642 3300010167 Unclassified 1243
108 Ga0466697_056925 3300042611 Bacteria 1204
109 Ga0415639_011075 3300038395 Bacteria 2720
110 Ga0466693_249210 3300042592 Bacteria 2400
111 Ga0466694_285313 3300042594 Unclassified 2541
112 Ga0466725_415913 3300042654 Bacteria 1758
113 Ga0466700_021013 3300042600 Bacteria 1389
114 Ga0466700_034457 3300042600 Unclassified 3370
115 Ga0466717_024714 3300042604 Bacteria 2894
116 Ga0466717_258580 3300042604 Bacteria 1509
117 Ga0466721_180011 3300042608 Unclassified 1867
118 Ga0123356_10602136 3300010049 Unclassified 1264
119 Ga0123353_10287758 3300010167 Bacteria 2518
120 Ga0123354_10163277 3300010882 Bacteria 2631
121 2227196106 2225789004 Unclassified 1451
122 2227573537 2225789004 Bacteria 2588
123 IMNBL1DRAFT_c0025176 3300000062 Bacteria 2287
124 JGI24705J35276_12222370 3300002504 Bacteria 2415
125 Ga0466710_375081 3300042613 Bacteria 2429
126 Ga0415639_214847 3300038395 Bacteria 1200
127 Ga0466657_015204 3300042582 Bacteria 1070
128 Ga0466693_186472 3300042592 Bacteria 2285
129 Ga0466694_238570 3300042594 Bacteria 1611
130 Ga0466695_095441 3300042595 Bacteria 2108
131 Ga0466695_124015 3300042595 Bacteria 1134
132 Ga0466735_099462 3300042624 Bacteria 3353
133 Ga0466700_449123 3300042600 Bacteria 2736
134 Ga0466714_087398 3300042603 Bacteria 1069
135 Ga0466717_001012 3300042604 Unclassified 3104
136 Ga0466717_102145 3300042604 Bacteria 2450
137 Ga0466721_392798 3300042608 Bacteria 1752
138 Ga0123355_10235944 3300009826 Bacteria 2602
139 Ga0123356_10106196 3300010049 Bacteria 2703
140 Ga0123356_10133114 3300010049 Bacteria 2439
141 Ga0123353_10219557 3300010167 Bacteria 2974
142 Ga0123353_10246361 3300010167 Unclassified 2772
143 Ga0123353_10404311 3300010167 Bacteria 2030
144 Ga0123353_10482372 3300010167 Bacteria 1814
145 JGI24696J40584_12935639 3300002834 Bacteria 1563
146 JGI24696J40584_12951952 3300002834 Bacteria 2293

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 2225789004 2227573537 2228120322 226
2 3300000062 IMNBL1DRAFT_c0068896 IMNBL1DRAFT_00688962 227
3 3300042604 Ga0466717_102145 Ga0466717_102145_204_998 244
4 3300042550 Ga0466656_007391 Ga0466656_007391_26_769 247
5 2225789003 2227070809 2227432472 248
6 3300042592 Ga0466693_345023 Ga0466693_345023_1868_2647 259
7 3300038395 Ga0415639_058691 Ga0415639_058691_556_1338 260
8 3300042592 Ga0466693_345217 Ga0466693_345217_1769_2551 260
9 3300042603 Ga0466714_092934 Ga0466714_092934_253_1035 260
10 3300002504 JGI24705J35276_12220256 JGI24705J35276_122202562 261
11 3300038395 Ga0415639_214847 Ga0415639_214847_291_1076 261
12 3300042600 Ga0466700_014891 Ga0466700_014891_1510_2295 261
13 3300042611 Ga0466697_056925 Ga0466697_056925_240_1025 261
14 3300042643 Ga0466704_400471 Ga0466704_400471_941_1726 261
15 3300010167 Ga0123353_10287758 Ga0123353_102877582 262
16 3300038395 Ga0415639_020705 Ga0415639_020705_1305_2093 262
17 3300042582 Ga0466657_015204 Ga0466657_015204_47_835 262
18 3300042617 Ga0466718_063280 Ga0466718_063280_2219_3007 262
19 3300010049 Ga0123356_10151348 Ga0123356_101513482 263
20 3300010167 Ga0123353_11033382 Ga0123353_110333821 263
21 3300042600 Ga0466700_034457 Ga0466700_034457_2186_2977 263
22 3300042608 Ga0466721_392798 Ga0466721_392798_764_1555 263
23 iso_pr_bacteria 2820089333 2820092022 263
24 2225789004 2227268844 2227717234 264
25 2225789004 2227466267 2227905264 264
26 3300010167 Ga0123353_10858642 Ga0123353_108586422 264
27 3300010167 Ga0123353_10938236 Ga0123353_109382361 264
28 3300024582 Ga0265387_1019102 Ga0265387_10191022 264
29 3300024582 Ga0265387_1023470 Ga0265387_10234702 264
30 3300038395 Ga0415639_013018 Ga0415639_013018_220_1014 264
31 3300038395 Ga0415639_042645 Ga0415639_042645_63_857 264
32 3300038395 Ga0415639_052975 Ga0415639_052975_1329_2123 264
33 3300038395 Ga0415639_054131 Ga0415639_054131_218_1012 264
34 3300042550 Ga0466656_274264 Ga0466656_274264_142_936 264
35 3300042592 Ga0466693_249210 Ga0466693_249210_161_955 264
36 3300042592 Ga0466693_347942 Ga0466693_347942_58_852 264
37 3300042594 Ga0466694_238570 Ga0466694_238570_640_1434 264
38 3300042596 Ga0466696_221709 Ga0466696_221709_1497_2291 264
39 3300042596 Ga0466696_371525 Ga0466696_371525_1678_2472 264
40 3300042600 Ga0466700_008978 Ga0466700_008978_120_914 264
41 3300042600 Ga0466700_021013 Ga0466700_021013_541_1335 264
42 3300042601 Ga0466707_019467 Ga0466707_019467_2070_2864 264
43 3300042601 Ga0466707_196440 Ga0466707_196440_456_1250 264
44 3300042604 Ga0466717_024714 Ga0466717_024714_352_1146 264
45 3300042604 Ga0466717_258580 Ga0466717_258580_514_1308 264
46 3300042607 Ga0466720_109270 Ga0466720_109270_663_1457 264
47 3300042608 Ga0466721_180011 Ga0466721_180011_299_1093 264
48 3300042612 Ga0466705_274777 Ga0466705_274777_531_1325 264
49 3300042613 Ga0466710_375081 Ga0466710_375081_182_976 264
50 3300042621 Ga0466729_316079 Ga0466729_316079_1392_2186 264
51 3300042623 Ga0466734_135998 Ga0466734_135998_997_1791 264
52 3300042624 Ga0466735_099462 Ga0466735_099462_2008_2802 264
53 3300042648 Ga0466709_362388 Ga0466709_362388_472_1266 264
54 3300042649 Ga0466724_36217 Ga0466724_36217_58_852 264
55 3300042656 Ga0466732_127823 Ga0466732_127823_1711_2505 264
56 iso_pr_bacteria 2820080004 2820082731 264
57 iso_pr_bacteria 2820234266 2820234390 264
58 iso_pr_bacteria 2820327087 2820329819 264
59 iso_pr_bacteria 2820657860 2820658144 264
60 2225789004 2227182484 2227600775 265
61 2225789004 2227196106 2227620026 265
62 2225789004 2227465166 2227902861 265
63 2225789004 2227510203 2228003559 265
64 2225789004 2227606583 2228175870 265
65 3300000062 IMNBL1DRAFT_c0025176 IMNBL1DRAFT_00251762 265
66 3300000062 IMNBL1DRAFT_c0025423 IMNBL1DRAFT_00254231 265
67 3300002450 JGI24695J34938_10041120 JGI24695J34938_100411201 265
68 3300002450 JGI24695J34938_10048318 JGI24695J34938_100483182 265
69 3300002504 JGI24705J35276_12222370 JGI24705J35276_122223703 265
70 3300002834 JGI24696J40584_12889885 JGI24696J40584_128898852 265
71 3300002834 JGI24696J40584_12923712 JGI24696J40584_129237122 265
72 3300002834 JGI24696J40584_12935639 JGI24696J40584_129356392 265
73 3300002834 JGI24696J40584_12951952 JGI24696J40584_129519522 265
74 3300002834 JGI24696J40584_12955790 JGI24696J40584_129557901 265
75 3300009826 Ga0123355_10202907 Ga0123355_102029073 265
76 3300009826 Ga0123355_10235944 Ga0123355_102359442 265
77 3300009826 Ga0123355_10240615 Ga0123355_102406151 265
78 3300009826 Ga0123355_10312022 Ga0123355_103120222 265
79 3300009826 Ga0123355_10628273 Ga0123355_106282731 265
80 3300010049 Ga0123356_10056397 Ga0123356_100563973 265
81 3300010049 Ga0123356_10069058 Ga0123356_100690583 265
82 3300010049 Ga0123356_10090472 Ga0123356_100904723 265
83 3300010049 Ga0123356_10106196 Ga0123356_101061962 265
84 3300010049 Ga0123356_10133114 Ga0123356_101331142 265
85 3300010049 Ga0123356_10592381 Ga0123356_105923812 265
86 3300010049 Ga0123356_10602136 Ga0123356_106021362 265
87 3300010167 Ga0123353_10096422 Ga0123353_100964222 265
88 3300010167 Ga0123353_10219557 Ga0123353_102195572 265
89 3300010167 Ga0123353_10243688 Ga0123353_102436882 265
90 3300010167 Ga0123353_10246361 Ga0123353_102463614 265
91 3300010167 Ga0123353_10271861 Ga0123353_102718612 265
92 3300010167 Ga0123353_10283049 Ga0123353_102830492 265
93 3300010167 Ga0123353_10318360 Ga0123353_103183602 265
94 3300010167 Ga0123353_10329600 Ga0123353_103296002 265
95 3300010167 Ga0123353_10352939 Ga0123353_103529391 265
96 3300010167 Ga0123353_10353553 Ga0123353_103535531 265
97 3300010167 Ga0123353_10623683 Ga0123353_106236832 265
98 3300010167 Ga0123353_11007767 Ga0123353_110077672 265
99 3300010882 Ga0123354_10163277 Ga0123354_101632773 265
100 3300024582 Ga0265387_1003078 Ga0265387_10030782 265
101 3300038395 Ga0415639_011075 Ga0415639_011075_131_928 265
102 3300042592 Ga0466693_026390 Ga0466693_026390_424_1221 265
103 3300042592 Ga0466693_186472 Ga0466693_186472_1443_2240 265
104 3300042592 Ga0466693_203834 Ga0466693_203834_417_1214 265
105 3300042592 Ga0466693_391822 Ga0466693_391822_281_1078 265
106 3300042594 Ga0466694_125744 Ga0466694_125744_155_952 265
107 3300042594 Ga0466694_285313 Ga0466694_285313_1569_2366 265
108 3300042595 Ga0466695_095441 Ga0466695_095441_1273_2070 265
109 3300042597 Ga0466699_376958 Ga0466699_376958_1459_2256 265
110 3300042600 Ga0466700_141227 Ga0466700_141227_304_1101 265
111 3300042600 Ga0466700_247879 Ga0466700_247879_197_994 265
112 3300042600 Ga0466700_449123 Ga0466700_449123_1583_2380 265
113 3300042603 Ga0466714_087398 Ga0466714_087398_37_834 265
114 3300042603 Ga0466714_168876 Ga0466714_168876_1458_2255 265
115 3300042608 Ga0466721_197600 Ga0466721_197600_1425_2222 265
116 3300042610 Ga0466698_357990 Ga0466698_357990_132_929 265
117 3300042611 Ga0466697_109466 Ga0466697_109466_88_885 265
118 3300042612 Ga0466705_041216 Ga0466705_041216_1492_2289 265
119 3300042613 Ga0466710_092453 Ga0466710_092453_694_1491 265
120 3300042635 Ga0466702_236329 Ga0466702_236329_587_1384 265
121 3300042654 Ga0466725_254467 Ga0466725_254467_1226_2023 265
122 3300042654 Ga0466725_415913 Ga0466725_415913_855_1652 265
123 3300042654 Ga0466725_451890 Ga0466725_451890_2028_2825 265
124 3300002462 JGI24702J35022_10253905 JGI24702J35022_102539051 266
125 3300002501 JGI24703J35330_11473766 JGI24703J35330_114737662 266
126 3300002834 JGI24696J40584_12951607 JGI24696J40584_129516071 266
127 3300009784 Ga0123357_10341228 Ga0123357_103412282 266
128 3300009826 Ga0123355_10116081 Ga0123355_101160813 266
129 3300009826 Ga0123355_10341261 Ga0123355_103412612 266
130 3300009826 Ga0123355_10982239 Ga0123355_109822391 266
131 3300010049 Ga0123356_10133482 Ga0123356_101334821 266
132 3300010049 Ga0123356_10283874 Ga0123356_102838742 266
133 3300010167 Ga0123353_10296886 Ga0123353_102968862 266
134 3300010167 Ga0123353_10404311 Ga0123353_104043112 266
135 3300010167 Ga0123353_10482372 Ga0123353_104823721 266
136 3300024582 Ga0265387_1005173 Ga0265387_10051732 266
137 3300042595 Ga0466695_331297 Ga0466695_331297_234_1034 266
138 3300042608 Ga0466721_056945 Ga0466721_056945_1582_2382 266
139 3300005201 Ga0072941_1191741 Ga0072941_11917413 267
140 3300010167 Ga0123353_11299198 Ga0123353_112991981 267
141 3300038395 Ga0415639_032069 Ga0415639_032069_204_1007 267
142 3300042604 Ga0466717_002232 Ga0466717_002232_1509_2312 267
143 3300042624 Ga0466735_031148 Ga0466735_031148_271_1074 267
144 3300038395 Ga0415639_085511 Ga0415639_085511_1337_2143 268
145 3300042550 Ga0466656_069799 Ga0466656_069799_341_1147 268
146 3300042595 Ga0466695_124015 Ga0466695_124015_280_1086 268
147 3300042596 Ga0466696_237332 Ga0466696_237332_1621_2427 268
148 3300042598 Ga0466701_060836 Ga0466701_060836_610_1416 268
149 3300010167 Ga0123353_10247790 Ga0123353_102477902 269
150 3300042604 Ga0466717_001012 Ga0466717_001012_880_1695 271
151 3300009826 Ga0123355_10219951 Ga0123355_102199513 273

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01695 IstB_IS21 IstB-like ATP binding protein 17 252 0.99
PF00308 Bac_DnaA Bacterial DnaA ATPAse domain 110 210 0.86
PF00004 AAA ATPase family associated with various cellular activities (AAA) 110 180 0.7

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01695 GO:0005524 ATP binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.74 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.