Protein Family IF02492
Metagenome
Isolate
129
Members
72
Samples
102
Scaffolds
147.11
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10218415|Ga0123355_102184153
- Length
- 151 aa
- Sequence
- VTVLVQIVNESNNPLPKYQTAGAAGMDIQAYLPDGPIEIAPGERALIGTGIKVSIPSGFEIQVRSRSGMALKKGVTVANAPGTIDEDYRGEVGVIMINHGTETITVNSGDRVAQIVLQKVPRIEWSLTDMLSDTERGEGGFGSTKTLGRG*
Sample Types
Isolate
20.9%
Metagenome
79.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.7%
Ixodidae
24.3%
Unclassified
17.1%
Kalotermitidae
17.1%
Termopsidae
4.3%
Passalidae
4.3%
Rhinotermitidae
2.9%
Pseudococcidae
1.4%
Hodotermitidae
1.4%
Armadillidiidae
1.4%
Taxonomy
Archaea
1
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2548876922 | Rickettsia sibirica mongolitimonae HA-91 | Isolate | Ixodidae |
| 2 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 3 | 2511231061 | Rickettsia slovaca 13-B | Isolate | Ixodidae |
| 4 | 2597489904 | Rickettsia helvetica C9P9 | Isolate | Ixodidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 8 | 2718218151 | Rickettsia rickettsii Iowa Large Clone | Isolate | Ixodidae |
| 9 | 2820080004 | Unclassified Proteobacteria Lab288P4bin34 | Isolate | Unclassified |
| 10 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 640753045 | Rickettsia canadensis McKiel | Isolate | Ixodidae |
| 13 | 641228503 | Rickettsia massiliae MTU5 | Isolate | Ixodidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 20 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 21 | 647533204 | Rickettsia endosymbiont of Ixodes scapularis | Isolate | Ixodidae |
| 22 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 23 | 2718217968 | Rickettsia rickettsii Iowa Small Clone | Isolate | Ixodidae |
| 24 | 2582581025 | Rickettsia tamurae buchneri ISO7 | Isolate | Ixodidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 28 | 644736402 | Rickettsia africae ESF-5 | Isolate | Ixodidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 33 | 2811994999 | Candidatus Rickettsia amblyommii An13 | Isolate | Ixodidae |
| 34 | 2834762790 | Rickettsia fournieri AUS118 | Isolate | Unclassified |
| 35 | 638341178 | Rickettsia sibirica 246 | Isolate | Unclassified |
| 36 | 650716082 | Rickettsia conorii heilongjiangensis 054 | Isolate | Pseudococcidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 2820101058 | Unclassified Proteobacteria Emb289P4bin76 | Isolate | Unclassified |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 44 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 45 | 2820056190 | Unclassified Proteobacteria Nt197P4bin9 | Isolate | Unclassified |
| 46 | 2548876780 | Rickettsia sibirica BJ-90 | Isolate | Ixodidae |
| 47 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 48 | 2855972776 | Rickettsia colombianensi Adcor 2 | Isolate | Ixodidae |
| 49 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 50 | 8068887342 | Rickettsia asiatica Maytaro1284 | Isolate | Ixodidae |
| 51 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 52 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 53 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 54 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 55 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 56 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 57 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 58 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 59 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 60 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 61 | 2811995359 | Rickettsia bellii An04 | Isolate | Ixodidae |
| 62 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 63 | 640753044 | Rickettsia bellii OSU 85-389 | Isolate | Ixodidae |
| 64 | 644736403 | Rickettsia peacockii Rustic | Isolate | Ixodidae |
| 65 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 66 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 67 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 68 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 69 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 70 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 71 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 72 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_175300 | 3300042612 | Bacteria | 5208 |
| 2 | Ga0123357_10007666 | 3300009784 | Bacteria | 13387 |
| 3 | Ga0123355_10218415 | 3300009826 | Archaea | 2747 |
| 4 | Ga0123353_11212894 | 3300010167 | Bacteria | 989 |
| 5 | Ga0466704_075296 | 3300042643 | Bacteria | 42602 |
| 6 | Ga0466704_231510 | 3300042643 | Bacteria | 12191 |
| 7 | Ga0466709_033772 | 3300042648 | Bacteria | 16857 |
| 8 | Ga0466715_035167 | 3300042616 | Bacteria | 10237 |
| 9 | Ga0466707_417526 | 3300042601 | Bacteria | 3367 |
| 10 | Ga0466713_068672 | 3300042602 | Bacteria | 133468 |
| 11 | Ga0466692_162372 | 3300042591 | Bacteria | 12543 |
| 12 | Ga0466696_205335 | 3300042596 | Bacteria | 5693 |
| 13 | 2227298018 | 2225789004 | Unclassified | 1227 |
| 14 | IMNBL1DRAFT_c0000125 | 3300000062 | Bacteria | 68757 |
| 15 | JGI24705J35276_12231469 | 3300002504 | Bacteria | 3950 |
| 16 | JGI24699J35502_10624727 | 3300002509 | Bacteria | 701 |
| 17 | Ga0123357_10002140 | 3300009784 | Bacteria | 21771 |
| 18 | Ga0123356_13053372 | 3300010049 | Bacteria | 584 |
| 19 | Ga0123354_10001008 | 3300010882 | Bacteria | 32139 |
| 20 | Ga0123354_10032711 | 3300010882 | Bacteria | 8149 |
| 21 | Ga0123354_10510057 | 3300010882 | Bacteria | 931 |
| 22 | Ga0466735_126100 | 3300042624 | Bacteria | 1635 |
| 23 | Ga0466735_213590 | 3300042624 | Bacteria | 9573 |
| 24 | Ga0466704_000408 | 3300042643 | Unclassified | 3850 |
| 25 | Ga0466704_307452 | 3300042643 | Bacteria | 9667 |
| 26 | Ga0466704_388038 | 3300042643 | Bacteria | 49542 |
| 27 | Ga0466727_232046 | 3300042655 | Bacteria | 1012 |
| 28 | Ga0466710_097122 | 3300042613 | Bacteria | 1691 |
| 29 | Ga0466711_149623 | 3300042615 | Bacteria | 5408 |
| 30 | Ga0466715_387075 | 3300042616 | Bacteria | 1688 |
| 31 | Ga0466723_318597 | 3300042618 | Bacteria | 1988 |
| 32 | Ga0466726_254431 | 3300042619 | Bacteria | 13408 |
| 33 | Ga0466707_254848 | 3300042601 | Bacteria | 1871 |
| 34 | Ga0466716_021974 | 3300042605 | Bacteria | 12034 |
| 35 | Ga0466719_480690 | 3300042606 | Bacteria | 3668 |
| 36 | Ga0264413_149920 | 3300024493 | Bacteria | 1525 |
| 37 | Ga0466691_123961 | 3300042593 | Bacteria | 12614 |
| 38 | Ga0466696_383570 | 3300042596 | Bacteria | 1501 |
| 39 | Ga0466696_395743 | 3300042596 | Bacteria | 2203 |
| 40 | Ga0068305_10085523 | 3300005083 | Bacteria | 7525 |
| 41 | Ga0072941_1145457 | 3300005201 | Bacteria | 10391 |
| 42 | Ga0123357_10002699 | 3300009784 | Bacteria | 20004 |
| 43 | Ga0123357_10163709 | 3300009784 | Bacteria | 2657 |
| 44 | Ga0123357_10375283 | 3300009784 | Bacteria | 1327 |
| 45 | Ga0466735_011321 | 3300042624 | Bacteria | 3645 |
| 46 | Ga0466735_170175 | 3300042624 | Bacteria | 3386 |
| 47 | Ga0466727_064569 | 3300042655 | Bacteria | 47217 |
| 48 | Ga0466706_148547 | 3300042599 | Bacteria | 7590 |
| 49 | Ga0466700_003507 | 3300042600 | Bacteria | 8143 |
| 50 | Ga0160445_100117 | 3300012847 | Bacteria | 70337 |
| 51 | Ga0466656_177309 | 3300042550 | Bacteria | 1454 |
| 52 | Ga0466693_343873 | 3300042592 | Bacteria | 1659 |
| 53 | Ga0466696_005519 | 3300042596 | Bacteria | 9214 |
| 54 | IMNBL1DRAFT_c0001285 | 3300000062 | Bacteria | 18910 |
| 55 | Ga0123357_10017367 | 3300009784 | Unclassified | 9520 |
| 56 | Ga0123354_10001055 | 3300010882 | Bacteria | 31731 |
| 57 | Ga0466708_261768 | 3300042652 | Bacteria | 7342 |
| 58 | Ga0466707_252850 | 3300042601 | Bacteria | 49003 |
| 59 | Ga0466707_289038 | 3300042601 | Bacteria | 1564 |
| 60 | Ga0466722_011306 | 3300042609 | Bacteria | 1455 |
| 61 | Ga0466722_260109 | 3300042609 | Bacteria | 210615 |
| 62 | 2227670447 | 2225789004 | Bacteria | 1900 |
| 63 | JGI24705J35276_12237518 | 3300002504 | Bacteria | 11565 |
| 64 | Ga0123357_10003901 | 3300009784 | Bacteria | 17309 |
| 65 | Ga0123353_10314681 | 3300010167 | Bacteria | 2380 |
| 66 | Ga0123353_11198836 | 3300010167 | Bacteria | 996 |
| 67 | Ga0123353_11407311 | 3300010167 | Bacteria | 896 |
| 68 | Ga0123354_10000692 | 3300010882 | Bacteria | 35955 |
| 69 | Ga0466700_078267 | 3300042600 | Bacteria | 7640 |
| 70 | IMNBL1DRAFT_c0000715 | 3300000062 | Bacteria | 26478 |
| 71 | JGI24702J35022_10092856 | 3300002462 | Bacteria | 1645 |
| 72 | Ga0123356_10534235 | 3300010049 | Bacteria | 1332 |
| 73 | Ga0123354_10043588 | 3300010882 | Unclassified | 6895 |
| 74 | Ga0123354_10056534 | 3300010882 | Bacteria | 5858 |
| 75 | Ga0466734_059380 | 3300042623 | Bacteria | 1590 |
| 76 | Ga0466704_563024 | 3300042643 | Bacteria | 7104 |
| 77 | Ga0466709_326869 | 3300042648 | Bacteria | 10418 |
| 78 | Ga0466723_232625 | 3300042618 | Bacteria | 6622 |
| 79 | Ga0466700_002314 | 3300042600 | Bacteria | 2276 |
| 80 | Ga0466698_086437 | 3300042610 | Bacteria | 2370 |
| 81 | Ga0466692_019618 | 3300042591 | Bacteria | 5081 |
| 82 | Ga0466693_309949 | 3300042592 | Bacteria | 1519 |
| 83 | Ga0466694_398134 | 3300042594 | Bacteria | 1882 |
| 84 | IMNBGM34_c006936 | 3300000036 | Bacteria | 1461 |
| 85 | IMNBL1DRAFT_c0003932 | 3300000062 | Bacteria | 9193 |
| 86 | Ga0466733_177551 | 3300042659 | Bacteria | 11744 |
| 87 | Ga0123356_11771999 | 3300010049 | Bacteria | 767 |
| 88 | Ga0466703_381909 | 3300042636 | Bacteria | 7072 |
| 89 | Ga0466703_425210 | 3300042636 | Bacteria | 5311 |
| 90 | Ga0466707_100574 | 3300042601 | Bacteria | 1671 |
| 91 | Ga0466693_105063 | 3300042592 | Bacteria | 1606 |
| 92 | JGI24699J35502_11134074 | 3300002509 | Bacteria | 28335 |
| 93 | Ga0123357_10000019 | 3300009784 | Bacteria | 142254 |
| 94 | Ga0123354_10037522 | 3300010882 | Bacteria | 7542 |
| 95 | Ga0466735_170351 | 3300042624 | Bacteria | 1153 |
| 96 | Ga0466718_103128 | 3300042617 | Bacteria | 1974 |
| 97 | Ga0466723_231412 | 3300042618 | Bacteria | 3123 |
| 98 | Ga0466692_011147 | 3300042591 | Bacteria | 45326 |
| 99 | Ga0466691_110230 | 3300042593 | Bacteria | 2089 |
| 100 | 2227108575 | 2225789004 | Bacteria | 38641 |
| 101 | IMNBL1DRAFT_c0005712 | 3300000062 | Bacteria | 7017 |
| 102 | JGI24695J34938_10363498 | 3300002450 | Bacteria | 638 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.