Protein Family IF02354

Metagenome Isolate
261 Members
78 Samples
236 Scaffolds
340.86 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10009033|Ga0123355_100090332
Length
407 aa
Sequence
MEKTRLSVLQVIHVTQKENQIFHLPYFFVLRIFILPRLTFCVKIISDNIKHKPKIIYRQGAIKMKKVVTFGELMLRLAPPGYERFTQCNELGATYGGGEANVAVSLANYGLDAAFVTKLPKHDIGQAAVNSLRRYGVDTGKIVRGGDRVGIYFLEKGSNQRASKVIYDRAHSSIATAKPEDFDWDAIFDGVGWFHFTGITPALGPVVADICLDALKAAKAKGITISCDLNYRKNLWTKAEAKETMSKLVPYVDVCVANEEDCADVFGITSEGTDVTGGHLNHDGYISVAKQMVEKFGIKTMTITLRESHSANYNGWAAMLYDGTTHEAFFSKKYDIKNIVDRVGGGDSFGGGLIYSMLSGKGNQDALEFAVAASCLKHTVEGDFNLVSVAEVSSLLGGDGSGRVQR*

πŸ“Š Sample Types

Isolate 9.6%
Metagenome 90.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 35.1%
Termitidae 31.2%
Kalotermitidae 18.2%
Termopsidae 5.2%
Rhinotermitidae 5.2%
Passalidae 3.9%
Hodotermitidae 1.3%

🌳 Taxonomy

Archaea 2
Bacteria 244
Eukaryota 0
Viruses 0
Unclassified 15

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
2 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
3 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
4 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
5 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
6 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
7 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
8 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
9 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
10 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
11 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
12 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
13 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
14 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
15 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
16 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
17 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
20 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
21 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
22 2820450073 Unclassified Firmicutes Lab288P3bin186 Isolate Unclassified
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
29 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
30 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
31 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
34 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
35 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
36 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
37 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
40 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
41 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
42 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
43 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
44 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
45 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
46 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
47 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
48 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
49 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
50 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
51 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
52 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
53 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
54 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
55 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
56 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
57 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
58 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
59 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
60 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
61 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
62 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
63 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
64 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
65 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
66 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
67 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
68 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
69 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
70 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
71 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
72 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
73 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
74 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
75 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
76 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
77 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
78 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_172676 3300042612 Bacteria 3864
2 Ga0123355_10009033 3300009826 Bacteria 15108
3 Ga0123355_10624377 3300009826 Bacteria 1269
4 Ga0123356_10022515 3300010049 Bacteria 5949
5 Ga0123353_10142589 3300010167 Bacteria 3836
6 Ga0415639_009785 3300038395 Bacteria 8729
7 Ga0466690_221369 3300042590 Bacteria 4080
8 Ga0466692_148222 3300042591 Bacteria 2993
9 Ga0466696_484885 3300042596 Bacteria 3265
10 Ga0466735_168330 3300042624 Bacteria 1178
11 Ga0466704_003807 3300042643 Bacteria 58502
12 Ga0466704_481611 3300042643 Bacteria 1680
13 Ga0466708_019276 3300042652 Bacteria 21307
14 Ga0466708_037718 3300042652 Bacteria 27015
15 Ga0466727_276696 3300042655 Bacteria 1810
16 2227080789 2225789004 Bacteria 141909
17 2227463532 2225789004 Bacteria 25249
18 Ga0466711_322316 3300042615 Bacteria 2603
19 Ga0466711_498430 3300042615 Bacteria 11880
20 Ga0466723_005478 3300042618 Bacteria 26749
21 Ga0466723_078534 3300042618 Bacteria 15271
22 Ga0466728_053616 3300042620 Bacteria 5491
23 Ga0466714_060706 3300042603 Bacteria 4275
24 Ga0466716_202188 3300042605 Bacteria 8057
25 Ga0466705_385863 3300042612 Bacteria 13106
26 Ga0123355_10000084 3300009826 Bacteria 98802
27 Ga0123355_10001270 3300009826 Bacteria 35231
28 Ga0123355_10003500 3300009826 Bacteria 22531
29 Ga0123355_10016818 3300009826 Bacteria 11538
30 Ga0123355_10022345 3300009826 Bacteria 10139
31 Ga0123355_10426209 3300009826 Unclassified 1691
32 Ga0123356_10003229 3300010049 Bacteria 17133
33 Ga0123356_10079195 3300010049 Bacteria 3103
34 Ga0123353_10006534 3300010167 Bacteria 15535
35 Ga0123353_10207163 3300010167 Bacteria 3079
36 Ga0456237_0001380 3300041968 Bacteria 3862
37 Ga0466690_097514 3300042590 Bacteria 47205
38 Ga0466691_203953 3300042593 Bacteria 6505
39 Ga0466696_167826 3300042596 Bacteria 25872
40 Ga0466703_257576 3300042636 Bacteria 10645
41 Ga0466709_143257 3300042648 Bacteria 6557
42 Ga0466708_004545 3300042652 Bacteria 2890
43 Ga0466708_156092 3300042652 Bacteria 2950
44 Ga0466708_284220 3300042652 Bacteria 1505
45 IMNBL1DRAFT_c0000024 3300000062 Bacteria 141336
46 JGI24695J34938_10002437 3300002450 Bacteria 14238
47 JGI24702J35022_10000172 3300002462 Bacteria 34044
48 JGI24699J35502_11134160 3300002509 Bacteria 40832
49 Ga0123357_10000748 3300009784 Bacteria 32715
50 Ga0466711_200332 3300042615 Bacteria 2609
51 Ga0466711_503538 3300042615 Bacteria 4301
52 Ga0466723_030624 3300042618 Bacteria 7963
53 Ga0466723_032625 3300042618 Bacteria 3010
54 Ga0466729_132084 3300042621 Bacteria 1773
55 Ga0466700_285562 3300042600 Bacteria 1290
56 Ga0466707_050891 3300042601 Bacteria 2173
57 Ga0466716_012798 3300042605 Unclassified 15253
58 Ga0466716_359781 3300042605 Bacteria 3114
59 Ga0466722_041163 3300042609 Bacteria 36432
60 Ga0466722_096484 3300042609 Bacteria 25125
61 Ga0466705_019242 3300042612 Bacteria 21181
62 Ga0466732_131280 3300042656 Bacteria 3127
63 Ga0466733_142688 3300042659 Bacteria 9793
64 Ga0466733_200844 3300042659 Bacteria 3204
65 Ga0123355_10000623 3300009826 Bacteria 47876
66 Ga0123355_10040675 3300009826 Bacteria 7568
67 Ga0123355_10080312 3300009826 Bacteria 5208
68 Ga0123355_10202806 3300009826 Bacteria 2893
69 Ga0123356_10005307 3300010049 Bacteria 13139
70 Ga0123353_10334288 3300010167 Bacteria 2291
71 Ga0123353_10499311 3300010167 Archaea 1773
72 Ga0123354_10262442 3300010882 Bacteria 1721
73 Ga0466690_186424 3300042590 Bacteria 14924
74 Ga0466690_241549 3300042590 Bacteria 6321
75 Ga0466692_023044 3300042591 Bacteria 13738
76 Ga0466696_150620 3300042596 Bacteria 16871
77 Ga0466729_261672 3300042621 Bacteria 11519
78 Ga0466703_108089 3300042636 Bacteria 5033
79 Ga0466708_424313 3300042652 Bacteria 4406
80 IMNBL1DRAFT_c0002572 3300000062 Bacteria 12503
81 Ga0466711_080698 3300042615 Bacteria 6903
82 Ga0466715_212807 3300042616 Bacteria 12949
83 Ga0466723_029755 3300042618 Bacteria 48312
84 Ga0466726_270737 3300042619 Bacteria 2075
85 Ga0466728_229642 3300042620 Bacteria 12782
86 Ga0466700_310517 3300042600 Bacteria 2272
87 Ga0466719_415738 3300042606 Bacteria 31415
88 Ga0466721_259144 3300042608 Bacteria 2683
89 Ga0466733_111851 3300042659 Bacteria 82439
90 Ga0123355_10003643 3300009826 Bacteria 22191
91 Ga0123355_10016427 3300009826 Bacteria 11665
92 Ga0123355_10124275 3300009826 Bacteria 3992
93 Ga0123355_10137416 3300009826 Bacteria 3750
94 Ga0123353_10032089 3300010167 Unclassified 8151
95 Ga0123354_10018989 3300010882 Bacteria 10795
96 Ga0415639_002027 3300038395 Bacteria 68151
97 Ga0415639_003172 3300038395 Bacteria 32655
98 Ga0415639_014591 3300038395 Bacteria 2752
99 Ga0415639_015998 3300038395 Bacteria 9744
100 Ga0466691_160506 3300042593 Unclassified 1112
101 Ga0466696_085346 3300042596 Bacteria 29850
102 Ga0466696_124908 3300042596 Bacteria 2482
103 Ga0466703_092831 3300042636 Bacteria 29083
104 Ga0466704_439014 3300042643 Bacteria 20393
105 Ga0466704_589941 3300042643 Bacteria 37056
106 Ga0466709_067320 3300042648 Bacteria 1890
107 Ga0466708_040303 3300042652 Bacteria 10009
108 Ga0466708_301954 3300042652 Bacteria 10950
109 Ga0466727_263772 3300042655 Bacteria 1634
110 2227247445 2225789004 Bacteria 32539
111 AustNasuHG_c1005673 3300000089 Bacteria 4466
112 Ga0072940_1222660 3300005200 Bacteria 3325
113 Ga0466711_392680 3300042615 Bacteria 13459
114 Ga0466715_045012 3300042616 Bacteria 29415
115 Ga0466723_086014 3300042618 Bacteria 8631
116 Ga0466723_103313 3300042618 Bacteria 3608
117 Ga0466726_232618 3300042619 Bacteria 1103
118 Ga0466728_155100 3300042620 Bacteria 1941
119 Ga0466728_300142 3300042620 Bacteria 5166
120 Ga0466706_091071 3300042599 Bacteria 23757
121 Ga0466713_077712 3300042602 Bacteria 2362
122 Ga0466719_088431 3300042606 Bacteria 2439
123 Ga0466719_292450 3300042606 Bacteria 1727
124 Ga0123355_10005908 3300009826 Bacteria 18030
125 Ga0123355_10006222 3300009826 Bacteria 17638
126 Ga0123355_10008805 3300009826 Bacteria 15269
127 Ga0123355_10062678 3300009826 Unclassified 6000
128 Ga0123356_10029747 3300010049 Bacteria 5113
129 Ga0123356_10304464 3300010049 Bacteria 1700
130 Ga0123353_10109029 3300010167 Bacteria 4461
131 Ga0123353_10340711 3300010167 Bacteria 2264
132 Ga0123353_10371685 3300010167 Bacteria 2143
133 Ga0123353_10650407 3300010167 Bacteria 1492
134 Ga0415639_014590 3300038395 Unclassified 6690
135 Ga0466690_167416 3300042590 Bacteria 5323
136 Ga0466690_353532 3300042590 Bacteria 1923
137 Ga0466692_032505 3300042591 Bacteria 13462
138 Ga0466692_181926 3300042591 Bacteria 1204
139 Ga0466693_307407 3300042592 Bacteria 3137
140 Ga0466696_185497 3300042596 Bacteria 6962
141 Ga0466696_230688 3300042596 Bacteria 36968
142 Ga0466699_134833 3300042597 Bacteria 6505
143 Ga0466729_204223 3300042621 Bacteria 11381
144 Ga0466735_005607 3300042624 Bacteria 1440
145 Ga0466703_216125 3300042636 Bacteria 3140
146 Ga0466703_344032 3300042636 Bacteria 2458
147 Ga0466709_336303 3300042648 Bacteria 2365
148 Ga0466708_293118 3300042652 Bacteria 9389
149 Ga0466725_033054 3300042654 Bacteria 2415
150 Ga0466727_075987 3300042655 Bacteria 3546
151 Ga0466727_339219 3300042655 Bacteria 2065
152 2227136387 2225789004 Bacteria 8789
153 IMNBL1DRAFT_c0005266 3300000062 Bacteria 7456
154 AustNasuHG_c1007193 3300000089 Bacteria 3963
155 Ga0068302_10230795 3300005071 Bacteria 2169
156 Ga0466705_512058 3300042612 Bacteria 12752
157 Ga0466722_151804 3300042609 Bacteria 5043
158 Ga0466705_186069 3300042612 Bacteria 1457
159 Ga0466732_345754 3300042656 Bacteria 1688
160 Ga0466733_187127 3300042659 Bacteria 21177
161 Ga0123355_10000237 3300009826 Bacteria 70535
162 Ga0123355_10011507 3300009826 Bacteria 13643
163 Ga0123355_10061563 3300009826 Bacteria 6059
164 Ga0123355_10343975 3300009826 Bacteria 1984
165 Ga0123353_10646172 3300010167 Bacteria 1499
166 Ga0264413_124686 3300024493 Bacteria 14459
167 Ga0466690_225831 3300042590 Bacteria 3596
168 Ga0466690_381458 3300042590 Unclassified 4911
169 Ga0466691_003870 3300042593 Bacteria 15743
170 Ga0466691_092776 3300042593 Bacteria 3705
171 Ga0466696_455324 3300042596 Bacteria 9475
172 Ga0466703_316801 3300042636 Bacteria 11111
173 Ga0466704_581113 3300042643 Unclassified 7331
174 Ga0466709_028788 3300042648 Bacteria 3354
175 Ga0466708_237874 3300042652 Unclassified 3835
176 Ga0466725_020026 3300042654 Bacteria 4429
177 IMNBL1DRAFT_c0000313 3300000062 Bacteria 41252
178 IMNBL1DRAFT_c0005743 3300000062 Unclassified 6991
179 Ga0466705_424308 3300042612 Archaea 1988
180 Ga0466705_454860 3300042612 Bacteria 5276
181 Ga0466711_451724 3300042615 Bacteria 10804
182 Ga0466718_133520 3300042617 Bacteria 1185
183 Ga0466723_141225 3300042618 Bacteria 7974
184 Ga0466726_493384 3300042619 Bacteria 2903
185 Ga0466706_267058 3300042599 Bacteria 2327
186 Ga0466714_115472 3300042603 Bacteria 2937
187 Ga0466716_243712 3300042605 Bacteria 8092
188 Ga0466722_122667 3300042609 Bacteria 1706
189 Ga0123355_10000067 3300009826 Bacteria 112202
190 Ga0123355_10351965 3300009826 Bacteria 1950
191 Ga0415639_004419 3300038395 Bacteria 39690
192 Ga0466691_220159 3300042593 Bacteria 9528
193 Ga0466696_226157 3300042596 Bacteria 18197
194 Ga0466702_211047 3300042635 Bacteria 1440
195 Ga0466709_172755 3300042648 Bacteria 3213
196 2227358581 2225789004 Bacteria 27848
197 IMNBL1DRAFT_c0006112 3300000062 Bacteria 6677
198 AustNasuHG_c1005139 3300000089 Bacteria 4678
199 JGI24702J35022_10007757 3300002462 Bacteria 6124
200 JGI24697J35500_11274874 3300002507 Bacteria 11152
201 Ga0466711_328337 3300042615 Bacteria 19036
202 Ga0466711_501285 3300042615 Bacteria 1835
203 Ga0466706_274245 3300042599 Bacteria 7668
204 Ga0466721_090497 3300042608 Bacteria 167057
205 Ga0466697_039405 3300042611 Bacteria 5184
206 Ga0466733_208167 3300042659 Bacteria 31218
207 Ga0123355_10047528 3300009826 Unclassified 6978
208 Ga0123356_10462428 3300010049 Unclassified 1419
209 Ga0123353_10074561 3300010167 Bacteria 5454
210 Ga0123353_10172480 3300010167 Bacteria 3432
211 Ga0123353_10720716 3300010167 Bacteria 1395
212 Ga0466694_035848 3300042594 Bacteria 2120
213 Ga0466694_113029 3300042594 Bacteria 1780
214 Ga0466699_009606 3300042597 Unclassified 1858
215 Ga0466703_158854 3300042636 Bacteria 6251
216 Ga0466703_315169 3300042636 Bacteria 3885
217 Ga0466704_092151 3300042643 Bacteria 9365
218 Ga0466704_210562 3300042643 Bacteria 22605
219 Ga0466709_091372 3300042648 Unclassified 2982
220 2227069685 2225789003 Bacteria 13369
221 IMNBL1DRAFT_c0001216 3300000062 Bacteria 19460
222 Ga0466711_143622 3300042615 Bacteria 9436
223 Ga0466711_488411 3300042615 Bacteria 1437
224 Ga0466715_040739 3300042616 Bacteria 29108
225 Ga0466715_062648 3300042616 Bacteria 13421
226 Ga0466715_169458 3300042616 Bacteria 14587
227 Ga0466715_280266 3300042616 Bacteria 6177
228 Ga0466726_248961 3300042619 Bacteria 1728
229 Ga0466726_312878 3300042619 Bacteria 9768
230 Ga0466728_119729 3300042620 Bacteria 13479
231 Ga0466706_142641 3300042599 Bacteria 6819
232 Ga0466700_276521 3300042600 Bacteria 1227
233 Ga0466719_172706 3300042606 Bacteria 5192
234 Ga0466719_220415 3300042606 Bacteria 2857
235 Ga0466719_512023 3300042606 Unclassified 2099
236 Ga0466722_260795 3300042609 Bacteria 4342

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00294 PfkB pfkB family carbohydrate kinase 64 382 0.87

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.