Protein Family IF02349

Metagenome Metatranscriptome Isolate
668 Members
255 Samples
474 Scaffolds
292.93 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10007110|Ga0123355_1000711012
Length
350 aa
Sequence
MIFHINYFMRKQKQMNPFVERTVILFEGVKFVANSIQTCYNVFKNRLKSRSKRNLINMLTIKNMRSSNNLADTFKGGVIMDVSNPEQARIAEGAGACAVMALERVPADIRAAGGISRMSDPKMIKAIMSAVSIPVMAKCRIGHIAEARILEAIEIDFIDESEVLSPADDKYHVDKRSFGVPFVCGARDLGEALRRILEGAAMIRTKGEAGTGDIVQAVRHMRAMQSEIRRLTSMSKDELYDTAKLLQVPFEFVKTVASKGKLPVPNFAAGGVATPADAALMMTLGAEGVFVGSGIFKSGNPSKRAAAIVTAVKNYNDAKILAMLSEDLGEAMVGINEDEIKVIMSERGK*

πŸ“Š Sample Types

Isolate 29.0%
Metagenome 70.8%
MAG 0.0%
Metatranscriptome 0.1%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 39.7%
Termitidae 14.6%
Apidae 13.8%
Kalotermitidae 6.1%
Blattidae 5.3%
Pyralidae 2.4%
Ixodidae 2.0%
Rhinotermitidae 1.6%
Termopsidae 1.6%
Argasidae 1.6%
Passalidae 1.6%
Scarabaeidae 1.2%
Elmidae 1.2%
Drosophilidae 0.8%
Bombycidae 0.8%
Tenebrionidae 0.8%
Noctuidae 0.4%
Nymphalidae 0.4%
Eresidae 0.4%
Culicidae 0.4%
Armadillidiidae 0.4%
Stratiomyidae 0.4%
Euphausiidae 0.4%
Calliphoridae 0.4%
Sarcophagidae 0.4%
Hodotermitidae 0.4%
Formicidae 0.4%
Portunidae 0.4%

🌳 Taxonomy

Archaea 18
Bacteria 615
Eukaryota 0
Viruses 0
Unclassified 35

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
2 2874209778 Francisella tularensis holarctica FT16C-B1 Isolate Ixodidae
3 2884203697 Commensalibacter melissae ESL0284 Isolate Apidae
4 2891591111 Commensalibacter sp. ESL0382 Isolate Unclassified
5 2891610497 Commensalibacter melissae ESL0367 Isolate Apidae
6 2506210010 Francisella tularensis tularensis FSC041 Isolate
7 2506210015 Francisella tularensis holarctica FSC185 Isolate
8 2513237339 Commensalibacter intestini A911 Isolate Drosophilidae
9 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
10 2590828840 Clostridium sp. 2 Isolate Termitidae
11 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
12 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
13 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
14 2820441105 Unclassified Firmicutes Lab288P3bin202 Isolate Unclassified
15 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
16 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
17 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
18 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
19 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
20 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
21 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
22 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
23 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
24 2820606014 Unclassified Firmicutes Emb289P1bin49 Isolate Unclassified
25 2820669764 Unclassified Firmicutes Co191P3bin30 Isolate Unclassified
26 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
27 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
28 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
29 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
30 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
31 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
32 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
33 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
34 637000113 Francisella tularensis tularensis FSC 198 Isolate
35 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
36 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
37 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
38 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
43 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
44 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
45 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
46 2775507278 Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 Isolate Nymphalidae
47 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
48 2791354884 Francisella endosymbiont of Amblyomma maculatum FLE-Am Isolate Ixodidae
49 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
50 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
51 2820510699 Unclassified Firmicutes Lab288P1bin40 Isolate Unclassified
52 2820526825 Unclassified Firmicutes Lab288P1bin16 Isolate Unclassified
53 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
54 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
55 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
56 2820679524 Unclassified Firmicutes Co191P1bin94 Isolate Unclassified
57 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
58 8022725327 Bacillus sp. SN10 Isolate Eresidae
59 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
60 8074745029 Commensalibacter melissae M0407 Isolate Apidae
61 8074748739 Commensalibacter sp. W8133 Isolate Apidae
62 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
63 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
64 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
65 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
66 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
67 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
68 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
69 2833052049 Commensalibacter melissae AMU001 Isolate Apidae
70 2835008077 Commensalibacter intestini DmL_052 Isolate Drosophilidae
71 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
72 2871595141 Francisella tularensis 503 Isolate Ixodidae
73 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
74 2785510743 Apibacter sp. ESL0404 Isolate Apidae
75 2788500057 Francisella-like endosymbiont F-Om Isolate Argasidae
76 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
77 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
78 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
79 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
80 2820611732 Unclassified Firmicutes Emb289P1bin19 Isolate Unclassified
81 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
82 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
83 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
84 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
85 2684622743 Methanobrevibacter cuticularis DSM11139 Isolate Unclassified
86 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
87 641736255 Paenibacillus larvae larvae BRL-230010 Isolate Unclassified
88 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
89 8012112996 Staphylococcus muscae ATCC 49910 Isolate
90 8074871419 Commensalibacter sp. M0133 Isolate Apidae
91 8074884171 Commensalibacter sp. M0355 Isolate Apidae
92 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
93 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
94 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
95 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
96 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
97 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
98 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
99 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
100 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
101 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
102 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
103 2891690481 Commensalibacter melissae ESL0390 Isolate Apidae
104 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
105 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
106 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
107 8112490586 Staphylococcus muscae CCM 4175 Isolate
108 2537562000 Bacillus cereus HD73 Isolate Pyralidae
109 2593339124 Clostridium sp. 4 Isolate Termitidae
110 2756170209 Commensalibacter sp. ESL0284 Isolate Unclassified
111 2772190782 Francisella persica ATCC VR-331 Isolate Argasidae
112 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
113 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
114 2820082748 Unclassified Proteobacteria Lab288P4bin14 Isolate Unclassified
115 2820094617 Unclassified Proteobacteria Lab288P3bin216 Isolate Unclassified
116 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
117 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
118 2820497731 Unclassified Firmicutes Lab288P1bin55 Isolate Unclassified
119 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
120 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
121 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
122 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
123 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
124 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
125 8074746876 Commensalibacter sp. W6292M3 Isolate Apidae
126 8074750600 Commensalibacter sp. W8163 Isolate Apidae
127 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
128 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
129 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
130 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
131 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
132 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
133 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
134 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
135 2820951912 Unclassified Acidobacteria Emb289P4bin26 Isolate Unclassified
136 2832343623 Apibacter adventoris wkB180 Isolate Apidae
137 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
138 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
139 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
140 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
141 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
142 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
143 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
144 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
145 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
146 2772190993 Unclassified Euryarchaeota Lab288P4bin101 Isolate Unclassified
147 2773857681 Unclassified Methanomassiliicoccaceae Lab288P1bin114 Isolate Unclassified
148 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
149 2791354885 Francisella endosymbiont of Ornithodoros moubata FLE-Om Isolate Argasidae
150 2806310685 Francisella persica ATCC VR-331 Isolate Argasidae
151 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
152 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
153 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
154 2820546020 Unclassified Firmicutes Lab288P1bin102 Isolate Unclassified
155 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
156 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
157 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
158 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
159 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
160 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
161 8074882376 Commensalibacter sp. M0270 Isolate Apidae
162 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
163 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
164 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
165 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
166 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
167 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
168 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
169 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
170 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
171 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
172 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
173 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
174 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
175 2891605396 Commensalibacter melissae ESL0392 Isolate Apidae
176 2891614855 Commensalibacter melissae ESL0379 Isolate Apidae
177 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
178 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
179 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
180 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
181 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
182 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
183 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
184 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
185 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
186 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
187 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
188 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
189 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
190 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
191 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
192 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
193 8074743123 Commensalibacter melissae M0402 Isolate Apidae
194 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
195 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
196 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
197 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
198 2832298047 Apibacter sp. wkB309 Isolate Apidae
199 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
200 2891675627 Commensalibacter melissae ESL0366 Isolate Apidae
201 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
202 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
203 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
204 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
205 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
206 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
207 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
208 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
209 2820558799 Unclassified Firmicutes Emb289P3bin74 Isolate Unclassified
210 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
211 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
212 2684622740 Methanobrevibacter filiformis DSM11501 Isolate Unclassified
213 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
214 8074832014 Commensalibacter melissae M0391 Isolate Apidae
215 8074875073 Commensalibacter sp. M0265 Isolate Apidae
216 8074878724 Commensalibacter sp. M0267 Isolate Apidae
217 8074880551 Commensalibacter sp. M0268 Isolate Apidae
218 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
219 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
220 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
221 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
222 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
223 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
224 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
225 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
226 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
227 2832372155 Apibacter adventoris wkB301 Isolate Apidae
228 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
229 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
230 2871564055 Francisella tularensis holarctica FT9C-G7 Isolate Ixodidae
231 2874203443 Francisella tularensis holarctica FT8C-4F Isolate Ixodidae
232 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
233 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
234 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
235 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
236 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
237 2773857693 Methanobrevibacter sp. Th196P3bin91 Isolate Unclassified
238 2773857697 Unclassified Methanomassiliicoccaceae Th196P4bin34 Isolate Unclassified
239 2820093073 Unclassified Proteobacteria Lab288P3bin233 Isolate Unclassified
240 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
241 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
242 2820528380 Unclassified Firmicutes Lab288P1bin143 Isolate Unclassified
243 2820610792 Unclassified Firmicutes Emb289P1bin33 Isolate Unclassified
244 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
245 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
246 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
247 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
248 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
249 8074737057 Commensalibacter sp. M0357 Isolate Apidae
250 8074867669 Commensalibacter sp. B14384M2 Isolate Apidae
251 8074869529 Commensalibacter sp. B14384M3 Isolate Apidae
252 8074873247 Commensalibacter sp. M0134 Isolate Apidae
253 8074876897 Commensalibacter sp. M0266 Isolate Apidae
254 2969145278 Bacillus cereus 29 Isolate Portunidae
255 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_001056 3300038395 Bacteria 25620
2 Ga0466657_193009 3300042582 Bacteria 1241
3 Ga0466692_098494 3300042591 Bacteria 22280
4 Ga0466693_257400 3300042592 Bacteria 1538
5 Ga0466691_170184 3300042593 Bacteria 9907
6 Ga0466696_181655 3300042596 Bacteria 4114
7 Ga0123355_10000694 3300009826 Bacteria 45782
8 Ga0123355_10000915 3300009826 Bacteria 40877
9 Ga0123355_10009033 3300009826 Bacteria 15108
10 Ga0123355_10015873 3300009826 Bacteria 11848
11 Ga0123355_10046071 3300009826 Bacteria 7093
12 Ga0123355_10050127 3300009826 Bacteria 6785
13 Ga0123355_10129397 3300009826 Bacteria 3893
14 Ga0123355_10143891 3300009826 Unclassified 3640
15 Ga0123355_10149898 3300009826 Unclassified 3546
16 Ga0123355_10174409 3300009826 Bacteria 3205
17 Ga0123356_10000397 3300010049 Bacteria 49777
18 Ga0123356_10006058 3300010049 Bacteria 12267
19 Ga0123356_10021767 3300010049 Bacteria 6052
20 Ga0123356_10088374 3300010049 Bacteria 2946
21 Ga0123356_10098787 3300010049 Bacteria 2796
22 Ga0123353_10000031 3300010167 Bacteria 160211
23 Ga0123353_10001014 3300010167 Bacteria 34344
24 Ga0123353_10040112 3300010167 Bacteria 7383
25 Ga0123353_10118304 3300010167 Bacteria 4261
26 Ga0123353_10331602 3300010167 Bacteria 2303
27 Ga0123353_10464482 3300010167 Bacteria 1858
28 Ga0123353_10789487 3300010167 Bacteria 1313
29 Ga0123354_10004047 3300010882 Bacteria 20583
30 Ga0123354_10012201 3300010882 Bacteria 13312
31 Ga0123354_10025143 3300010882 Bacteria 9390
32 Ga0466700_045183 3300042600 Bacteria 3288
33 Ga0466700_146611 3300042600 Bacteria 8156
34 Ga0466700_167889 3300042600 Bacteria 3613
35 Ga0466707_031817 3300042601 Bacteria 8529
36 Ga0466707_217907 3300042601 Bacteria 23324
37 Ga0466707_277390 3300042601 Bacteria 10123
38 Ga0466707_393370 3300042601 Bacteria 1059
39 Ga0466714_151878 3300042603 Bacteria 1227
40 Ga0466717_290889 3300042604 Bacteria 6355
41 Ga0466722_135133 3300042609 Unclassified 1299
42 IMNBGM34_c004626 3300000036 Bacteria 1854
43 IMNBL1DRAFT_c0000948 3300000062 Archaea 22360
44 JGI24703J35330_11747734 3300002501 Bacteria 7991
45 JGI24703J35330_11748869 3300002501 Bacteria 102501
46 Ga0466733_009154 3300042659 Bacteria 5341
47 Ga0466733_147243 3300042659 Bacteria 1580
48 Ga0466735_014699 3300042624 Unclassified 1444
49 Ga0466730_100922 3300042625 Bacteria 4503
50 Ga0466704_358858 3300042643 Bacteria 16012
51 Ga0466709_112735 3300042648 Bacteria 5599
52 Ga0466727_036506 3300042655 Bacteria 3208
53 Ga0466711_289943 3300042615 Bacteria 2525
54 Ga0466711_303131 3300042615 Bacteria 3917
55 Ga0466715_052418 3300042616 Bacteria 1259
56 Ga0466715_299499 3300042616 Bacteria 9218
57 Ga0466715_342442 3300042616 Bacteria 12330
58 Ga0466726_051801 3300042619 Unclassified 1622
59 Ga0466726_076428 3300042619 Bacteria 10475
60 Ga0466726_087111 3300042619 Bacteria 28008
61 Ga0466726_352161 3300042619 Bacteria 5586
62 Ga0415639_103538 3300038395 Bacteria 2936
63 Ga0466690_035126 3300042590 Bacteria 8523
64 Ga0466690_072766 3300042590 Bacteria 4830
65 Ga0466693_171715 3300042592 Bacteria 3010
66 Ga0466693_203473 3300042592 Bacteria 1721
67 Ga0123355_10000159 3300009826 Bacteria 81982
68 Ga0123355_10000305 3300009826 Bacteria 63082
69 Ga0123355_10007677 3300009826 Bacteria 16203
70 Ga0123355_10092979 3300009826 Bacteria 4775
71 Ga0123355_10180108 3300009826 Bacteria 3138
72 Ga0123355_10184081 3300009826 Bacteria 3093
73 Ga0123355_10321541 3300009826 Bacteria 2084
74 Ga0123356_10002452 3300010049 Bacteria 19816
75 Ga0123356_10010828 3300010049 Unclassified 8918
76 Ga0123356_10028371 3300010049 Bacteria 5244
77 Ga0123356_10100427 3300010049 Bacteria 2775
78 Ga0123356_10107409 3300010049 Bacteria 2689
79 Ga0123356_10176523 3300010049 Bacteria 2153
80 Ga0123353_10418305 3300010167 Bacteria 1987
81 Ga0123353_10567391 3300010167 Bacteria 1632
82 Ga0123353_10831560 3300010167 Unclassified 1269
83 Ga0466706_085765 3300042599 Bacteria 7741
84 Ga0466707_178508 3300042601 Unclassified 13030
85 Ga0466716_028167 3300042605 Bacteria 22705
86 Ga0466719_014365 3300042606 Bacteria 6494
87 Ga0466719_224843 3300042606 Bacteria 6501
88 Ga0466719_412414 3300042606 Unclassified 4568
89 Ga0466721_331189 3300042608 Bacteria 1850
90 Ga0466722_239085 3300042609 Bacteria 36142
91 2227219675 2225789004 Bacteria 33685
92 JGI24695J34938_10000273 3300002450 Bacteria 50542
93 JGI24695J34938_10000462 3300002450 Bacteria 39529
94 JGI24703J35330_11547396 3300002501 Unclassified 1218
95 JGI24700J35501_10930805 3300002508 Bacteria 24845
96 Ga0466733_138574 3300042659 Bacteria 2639
97 Ga0466733_164338 3300042659 Bacteria 1028
98 Ga0466703_213318 3300042636 Bacteria 1853
99 Ga0466704_207461 3300042643 Bacteria 16923
100 Ga0466704_322227 3300042643 Bacteria 202158
101 Ga0466704_441181 3300042643 Bacteria 1260
102 Ga0466709_062901 3300042648 Bacteria 45932
103 Ga0466709_269068 3300042648 Bacteria 7495
104 Ga0466727_055915 3300042655 Bacteria 1564
105 Ga0466727_283482 3300042655 Bacteria 5171
106 Ga0466715_505954 3300042616 Bacteria 45216
107 Ga0466723_248070 3300042618 Bacteria 10863
108 Ga0466726_026362 3300042619 Bacteria 4595
109 Ga0466726_072466 3300042619 Bacteria 4592
110 Ga0466726_309776 3300042619 Bacteria 1705
111 Ga0466728_051912 3300042620 Bacteria 14651
112 Ga0233288_1014196 3300022232 Bacteria 1393
113 Ga0415639_025277 3300038395 Bacteria 30818
114 Ga0466656_198877 3300042550 Bacteria 1185
115 Ga0466692_174483 3300042591 Bacteria 9780
116 Ga0466693_130736 3300042592 Bacteria 12242
117 Ga0466693_441101 3300042592 Bacteria 1300
118 Ga0466694_212432 3300042594 Bacteria 1226
119 Ga0123355_10000036 3300009826 Bacteria 135537
120 Ga0123355_10000118 3300009826 Bacteria 90212
121 Ga0123355_10000164 3300009826 Bacteria 81449
122 Ga0123355_10529460 3300009826 Bacteria 1437
123 Ga0123356_10001679 3300010049 Bacteria 24223
124 Ga0123356_10025565 3300010049 Bacteria 5549
125 Ga0123356_10144740 3300010049 Bacteria 2350
126 Ga0123356_10183994 3300010049 Bacteria 2114
127 Ga0123356_10457674 3300010049 Bacteria 1425
128 Ga0123353_10073374 3300010167 Bacteria 5499
129 Ga0123353_10408459 3300010167 Bacteria 2018
130 Ga0123353_10828728 3300010167 Bacteria 1272
131 Ga0123353_10846199 3300010167 Bacteria 1255
132 Ga0123354_10032561 3300010882 Bacteria 8169
133 Ga0466700_156279 3300042600 Bacteria 2934
134 Ga0466707_197078 3300042601 Bacteria 1040
135 Ga0466713_028433 3300042602 Bacteria 7216
136 Ga0466719_428025 3300042606 Bacteria 11155
137 Ga0466721_094122 3300042608 Bacteria 1398
138 Ga0466697_037930 3300042611 Bacteria 4338
139 IMNBL1DRAFT_c0000056 3300000062 Bacteria 106919
140 IMNBL1DRAFT_c0001340 3300000062 Unclassified 18561
141 JGI24695J34938_10021352 3300002450 Bacteria 3169
142 JGI24700J35501_10929466 3300002508 Bacteria 9308
143 JGI24699J35502_11133770 3300002509 Bacteria 15212
144 Ga0068305_10020321 3300005083 Bacteria 2088
145 Ga0074278_151332 3300005721 Bacteria 11214
146 Ga0123357_10000954 3300009784 Bacteria 29425
147 Ga0562377_0006 3300056842 Bacteria 3350072
148 Ga0466734_157290 3300042623 Bacteria 1505
149 Ga0466703_102634 3300042636 Bacteria 6214
150 Ga0466708_096726 3300042652 Bacteria 1809
151 Ga0466725_085766 3300042654 Bacteria 2503
152 Ga0466727_056512 3300042655 Bacteria 2590
153 Ga0466710_317464 3300042613 Bacteria 5879
154 Ga0466711_096900 3300042615 Bacteria 8920
155 Ga0466711_157654 3300042615 Bacteria 152365
156 Ga0466711_285818 3300042615 Bacteria 4987
157 Ga0466715_037900 3300042616 Bacteria 143938
158 Ga0466715_211062 3300042616 Bacteria 20965
159 Ga0466715_367383 3300042616 Bacteria 15471
160 Ga0466715_638803 3300042616 Bacteria 3278
161 Ga0466723_103752 3300042618 Bacteria 7970
162 Ga0466723_138561 3300042618 Archaea 2281
163 Ga0466723_197215 3300042618 Unclassified 1725
164 Ga0415639_000278 3300038395 Bacteria 21828
165 Ga0415639_067418 3300038395 Bacteria 6882
166 Ga0466657_239562 3300042582 Archaea 2107
167 Ga0466657_387498 3300042582 Bacteria 1520
168 Ga0466690_030815 3300042590 Bacteria 9770
169 Ga0466692_182340 3300042591 Bacteria 2806
170 Ga0466693_309893 3300042592 Bacteria 1643
171 Ga0123357_10190689 3300009784 Bacteria 2363
172 Ga0123355_10000440 3300009826 Bacteria 54865
173 Ga0123355_10001736 3300009826 Unclassified 30429
174 Ga0123355_10003140 3300009826 Bacteria 23600
175 Ga0123355_10005938 3300009826 Bacteria 17991
176 Ga0123355_10037648 3300009826 Bacteria 7867
177 Ga0123355_10200757 3300009826 Bacteria 2914
178 Ga0123355_10328809 3300009826 Bacteria 2051
179 Ga0123355_10619810 3300009826 Bacteria 1276
180 Ga0123356_10045074 3300010049 Bacteria 4104
181 Ga0123356_10085454 3300010049 Bacteria 2992
182 Ga0123356_10106302 3300010049 Unclassified 2702
183 Ga0123356_10110350 3300010049 Bacteria 2656
184 Ga0123353_10002385 3300010167 Bacteria 23342
185 Ga0123353_10008468 3300010167 Bacteria 14051
186 Ga0123353_10008469 3300010167 Bacteria 14051
187 Ga0123353_10024147 3300010167 Bacteria 9222
188 Ga0123353_10052041 3300010167 Bacteria 6537
189 Ga0123353_10053685 3300010167 Bacteria 6441
190 Ga0123353_10148582 3300010167 Bacteria 3744
191 Ga0123353_10182396 3300010167 Bacteria 3322
192 Ga0123353_10196094 3300010167 Bacteria 3183
193 Ga0123353_10270198 3300010167 Bacteria 2620
194 Ga0123353_10601570 3300010167 Bacteria 1571
195 Ga0123353_10766793 3300010167 Archaea 1339
196 Ga0123354_10190179 3300010882 Unclassified 2302
197 Ga0466706_073392 3300042599 Bacteria 4494
198 Ga0466706_202113 3300042599 Bacteria 25950
199 Ga0466706_236087 3300042599 Bacteria 1973
200 Ga0466707_054834 3300042601 Unclassified 8291
201 Ga0466707_176360 3300042601 Bacteria 1078
202 Ga0466707_393925 3300042601 Bacteria 1099
203 Ga0466707_413860 3300042601 Bacteria 24630
204 Ga0466713_049362 3300042602 Bacteria 4524
205 Ga0466713_111178 3300042602 Bacteria 28409
206 Ga0466714_139272 3300042603 Bacteria 3589
207 Ga0466719_052961 3300042606 Bacteria 2580
208 Ga0466719_371703 3300042606 Bacteria 2641
209 Ga0466722_106335 3300042609 Bacteria 9302
210 JGI24695J34938_10016511 3300002450 Bacteria 3751
211 Ga0068302_10063761 3300005071 Unclassified 1741
212 Ga0466732_336238 3300042656 Bacteria 3715
213 Ga0562377_0206 3300056842 Bacteria 152579
214 Ga0466705_114855 3300042612 Bacteria 4211
215 Ga0466705_133491 3300042612 Bacteria 6776
216 Ga0466708_011946 3300042652 Bacteria 38242
217 Ga0466725_057072 3300042654 Bacteria 6400
218 Ga0466725_308274 3300042654 Bacteria 1540
219 Ga0466705_493501 3300042612 Bacteria 3855
220 Ga0466710_354454 3300042613 Bacteria 1360
221 Ga0466711_036923 3300042615 Bacteria 13687
222 Ga0466711_379831 3300042615 Bacteria 2751
223 Ga0466715_487272 3300042616 Bacteria 4408
224 Ga0466728_096576 3300042620 Bacteria 2370
225 Ga0466728_343602 3300042620 Bacteria 6304
226 Ga0415639_097680 3300038395 Bacteria 1230
227 Ga0466656_232858 3300042550 Bacteria 2576
228 Ga0466690_192688 3300042590 Bacteria 2290
229 Ga0466690_253987 3300042590 Bacteria 13571
230 Ga0466693_268100 3300042592 Bacteria 1456
231 Ga0466691_103514 3300042593 Bacteria 21087
232 Ga0466691_164870 3300042593 Bacteria 2087
233 Ga0466691_166129 3300042593 Bacteria 7509
234 Ga0466691_218911 3300042593 Bacteria 11278
235 Ga0466696_027286 3300042596 Unclassified 8430
236 Ga0466696_291117 3300042596 Bacteria 3255
237 Ga0466696_369550 3300042596 Bacteria 15401
238 Ga0466699_205663 3300042597 Unclassified 1611
239 Ga0123357_10027378 3300009784 Bacteria 7704
240 Ga0123357_10138714 3300009784 Bacteria 2997
241 Ga0123357_10290792 3300009784 Bacteria 1669
242 Ga0123355_10000241 3300009826 Bacteria 70219
243 Ga0123355_10000873 3300009826 Bacteria 41692
244 Ga0123355_10002265 3300009826 Bacteria 27148
245 Ga0123355_10015853 3300009826 Bacteria 11856
246 Ga0123355_10020995 3300009826 Bacteria 10443
247 Ga0123355_10055017 3300009826 Bacteria 6444
248 Ga0123355_10107797 3300009826 Bacteria 4363
249 Ga0123355_10150115 3300009826 Bacteria 3542
250 Ga0123355_10329603 3300009826 Bacteria 2047
251 Ga0123355_10905176 3300009826 Bacteria 958
252 Ga0123356_10006256 3300010049 Bacteria 12025
253 Ga0123356_10006684 3300010049 Bacteria 11616
254 Ga0123356_10020280 3300010049 Archaea 6291
255 Ga0123356_10052843 3300010049 Bacteria 3780
256 Ga0123356_10155200 3300010049 Bacteria 2279
257 Ga0123356_10318156 3300010049 Bacteria 1668
258 Ga0123356_10371751 3300010049 Bacteria 1560
259 Ga0123356_10437326 3300010049 Unclassified 1454
260 Ga0123356_10712521 3300010049 Bacteria 1173
261 Ga0123353_10010210 3300010167 Bacteria 13066
262 Ga0123353_10058716 3300010167 Bacteria 6165
263 Ga0123353_10227236 3300010167 Bacteria 2913
264 Ga0123353_10295274 3300010167 Bacteria 2478
265 Ga0123353_10442906 3300010167 Bacteria 1915
266 Ga0123353_10945209 3300010167 Bacteria 1167
267 Ga0123354_10026902 3300010882 Bacteria 9070
268 Ga0466701_021579 3300042598 Bacteria 1771
269 Ga0466706_202227 3300042599 Bacteria 1020
270 Ga0466707_390221 3300042601 Bacteria 1300
271 Ga0466716_509453 3300042605 Bacteria 1559
272 Ga0466719_457003 3300042606 Bacteria 3256
273 Ga0466722_173548 3300042609 Bacteria 31010
274 2227560718 2225789004 Unclassified 14602
275 JGI24695J34938_10000253 3300002450 Bacteria 51796
276 JGI24695J34938_10034809 3300002450 Bacteria 2308
277 JGI24702J35022_10001106 3300002462 Bacteria 16770
278 JGI24702J35022_10005660 3300002462 Bacteria 7284
279 JGI24703J35330_11595512 3300002501 Bacteria 1356
280 JGI24703J35330_11643597 3300002501 Bacteria 1558
281 Ga0072941_1079263 3300005201 Bacteria 6171
282 Ga0466733_185693 3300042659 Bacteria 1507
283 Ga0466729_242568 3300042621 Archaea 50217
284 Ga0466734_031389 3300042623 Bacteria 4021
285 Ga0466730_074529 3300042625 Bacteria 8164
286 Ga0466703_009761 3300042636 Bacteria 12393
287 Ga0466703_122433 3300042636 Bacteria 1884
288 Ga0466704_096484 3300042643 Bacteria 2836
289 Ga0466709_028588 3300042648 Bacteria 5973
290 Ga0466708_038241 3300042652 Bacteria 5374
291 Ga0466725_224556 3300042654 Bacteria 1110
292 Ga0466727_132693 3300042655 Bacteria 19237
293 Ga0466705_424670 3300042612 Unclassified 1911
294 Ga0466710_231972 3300042613 Bacteria 1393
295 Ga0466711_036034 3300042615 Bacteria 28602
296 Ga0466715_489311 3300042616 Bacteria 15153
297 Ga0466715_517620 3300042616 Bacteria 33585
298 Ga0160441_100492 3300012825 Bacteria 28546
299 Ga0415639_003490 3300038395 Bacteria 11001
300 Ga0415639_237668 3300038395 Bacteria 2311
301 Ga0466690_028816 3300042590 Bacteria 10770
302 Ga0466690_066728 3300042590 Bacteria 8083
303 Ga0466690_122949 3300042590 Bacteria 6475
304 Ga0466690_136369 3300042590 Bacteria 17194
305 Ga0466692_100322 3300042591 Bacteria 97018
306 Ga0466693_202568 3300042592 Unclassified 1119
307 Ga0466696_006428 3300042596 Bacteria 6851
308 Ga0466696_248140 3300042596 Bacteria 16110
309 Ga0466696_415735 3300042596 Bacteria 7638
310 Ga0123357_10006993 3300009784 Bacteria 13877
311 Ga0123355_10000021 3300009826 Bacteria 153421
312 Ga0123355_10001733 3300009826 Bacteria 30437
313 Ga0123355_10003803 3300009826 Bacteria 21818
314 Ga0123355_10007110 3300009826 Bacteria 16694
315 Ga0123355_10069807 3300009826 Bacteria 5646
316 Ga0123355_10139423 3300009826 Bacteria 3715
317 Ga0123355_10141721 3300009826 Bacteria 3676
318 Ga0123355_10197533 3300009826 Bacteria 2946
319 Ga0123355_10237420 3300009826 Bacteria 2590
320 Ga0123355_10433931 3300009826 Bacteria 1669
321 Ga0123355_10629417 3300009826 Bacteria 1261
322 Ga0123356_10000658 3300010049 Bacteria 38042
323 Ga0123356_10052166 3300010049 Unclassified 3804
324 Ga0123353_10024222 3300010167 Bacteria 9209
325 Ga0123353_10100151 3300010167 Bacteria 4670
326 Ga0123354_10071300 3300010882 Bacteria 5016
327 Ga0123354_10145750 3300010882 Bacteria 2899
328 Ga0123354_10202867 3300010882 Bacteria 2173
329 Ga0466701_023827 3300042598 Bacteria 4526
330 Ga0466700_477570 3300042600 Bacteria 28301
331 Ga0466707_034587 3300042601 Bacteria 1356
332 Ga0466707_207111 3300042601 Bacteria 7842
333 Ga0466707_334643 3300042601 Bacteria 2655
334 Ga0466707_342922 3300042601 Bacteria 3520
335 Ga0466713_114403 3300042602 Bacteria 19166
336 Ga0466717_174364 3300042604 Bacteria 2291
337 Ga0466719_033556 3300042606 Unclassified 2207
338 Ga0466719_334905 3300042606 Bacteria 2706
339 Ga0466698_499723 3300042610 Unclassified 3401
340 2227066899 2225789003 Archaea 15730
341 2227563526 2225789004 Archaea 14360
342 JGI24703J35330_11747658 3300002501 Bacteria 7634
343 JGI24700J35501_10930415 3300002508 Bacteria 13787
344 Ga0068305_10005116 3300005083 Bacteria 49058
345 Ga0466733_074814 3300042659 Unclassified 8862
346 Ga0466735_085034 3300042624 Bacteria 2897
347 Ga0466703_205608 3300042636 Bacteria 10678
348 Ga0466709_013722 3300042648 Bacteria 2290
349 Ga0466708_161011 3300042652 Bacteria 8386
350 Ga0466725_096637 3300042654 Bacteria 1843
351 Ga0466725_426701 3300042654 Bacteria 1241
352 Ga0466710_287470 3300042613 Archaea 1175
353 Ga0466711_483171 3300042615 Bacteria 1936
354 Ga0466723_363209 3300042618 Bacteria 2026
355 Ga0466726_222188 3300042619 Bacteria 1274
356 Ga0466726_292104 3300042619 Bacteria 4119
357 Ga0466726_316859 3300042619 Bacteria 2311
358 Ga0466728_096830 3300042620 Bacteria 3908
359 Ga0466729_150563 3300042621 Bacteria 1948
360 Ga0160455_101635 3300012837 Bacteria 6131
361 Ga0415639_004836 3300038395 Bacteria 13268
362 Ga0466692_085757 3300042591 Bacteria 10543
363 Ga0466691_110603 3300042593 Bacteria 1906
364 Ga0123357_10083433 3300009784 Bacteria 4194
365 Ga0123357_10390382 3300009784 Bacteria 1280
366 Ga0123355_10000009 3300009826 Bacteria 191038
367 Ga0123355_10001006 3300009826 Bacteria 39095
368 Ga0123355_10010550 3300009826 Bacteria 14178
369 Ga0123355_10022431 3300009826 Bacteria 10121
370 Ga0123355_10023255 3300009826 Bacteria 9951
371 Ga0123355_10025506 3300009826 Bacteria 9517
372 Ga0123355_10056597 3300009826 Bacteria 6345
373 Ga0123355_10059235 3300009826 Bacteria 6190
374 Ga0123355_10063243 3300009826 Bacteria 5969
375 Ga0123355_10102636 3300009826 Bacteria 4497
376 Ga0123355_10106755 3300009826 Bacteria 4389
377 Ga0123355_10439895 3300009826 Bacteria 1651
378 Ga0123355_10505866 3300009826 Bacteria 1487
379 Ga0123355_10620532 3300009826 Bacteria 1275
380 Ga0123356_10000187 3300010049 Bacteria 71353
381 Ga0123356_10003861 3300010049 Bacteria 15614
382 Ga0123356_10004270 3300010049 Unclassified 14782
383 Ga0123356_10004294 3300010049 Bacteria 14743
384 Ga0123356_10091918 3300010049 Bacteria 2893
385 Ga0123356_10094185 3300010049 Bacteria 2859
386 Ga0123356_10298237 3300010049 Bacteria 1716
387 Ga0123356_10371505 3300010049 Archaea 1560
388 Ga0123356_10610723 3300010049 Bacteria 1256
389 Ga0123353_10000119 3300010167 Bacteria 93234
390 Ga0123353_10020742 3300010167 Bacteria 9831
391 Ga0123353_10130736 3300010167 Bacteria 4029
392 Ga0123353_10276836 3300010167 Bacteria 2581
393 Ga0123354_10031698 3300010882 Bacteria 8290
394 Ga0466706_256592 3300042599 Bacteria 28348
395 Ga0466714_094553 3300042603 Bacteria 52205
396 Ga0466721_381796 3300042608 Bacteria 115209
397 Ga0466722_006350 3300042609 Bacteria 11807
398 HBC_ctgsDRAFT_1000016 3300000333 Bacteria 46665
399 JGI24695J34938_10014519 3300002450 Bacteria 4079
400 JGI24697J35500_11274769 3300002507 Bacteria 9583
401 Ga0466729_252078 3300042621 Bacteria 2995
402 Ga0466703_020352 3300042636 Bacteria 2717
403 Ga0466703_163381 3300042636 Unclassified 1629
404 Ga0466703_168858 3300042636 Bacteria 1965
405 Ga0466703_408774 3300042636 Bacteria 21600
406 Ga0466704_127185 3300042643 Bacteria 10095
407 Ga0466708_298806 3300042652 Bacteria 30247
408 Ga0466727_028886 3300042655 Bacteria 9072
409 Ga0466711_142170 3300042615 Bacteria 7615
410 Ga0466715_086418 3300042616 Bacteria 17729
411 Ga0466715_535374 3300042616 Bacteria 53013
412 Ga0466723_178606 3300042618 Bacteria 5259
413 Ga0466728_299084 3300042620 Bacteria 35234
414 Ga0466729_027132 3300042621 Bacteria 2018
415 Ga0466729_134408 3300042621 Bacteria 4687
416 Ga0466729_144726 3300042621 Bacteria 3062
417 Ga0466656_237607 3300042550 Bacteria 23595
418 Ga0466657_353063 3300042582 Archaea 50295
419 Ga0466692_110912 3300042591 Bacteria 24580
420 Ga0466693_036193 3300042592 Bacteria 2230
421 Ga0466693_264280 3300042592 Unclassified 4571
422 Ga0466695_286163 3300042595 Bacteria 6483
423 Ga0466696_090797 3300042596 Bacteria 3932
424 Ga0123357_10435607 3300009784 Bacteria 1153
425 Ga0123355_10000127 3300009826 Bacteria 88118
426 Ga0123355_10000182 3300009826 Bacteria 77682
427 Ga0123355_10002249 3300009826 Bacteria 27250
428 Ga0123355_10006817 3300009826 Bacteria 16994
429 Ga0123355_10014717 3300009826 Bacteria 12250
430 Ga0123355_10038778 3300009826 Bacteria 7747
431 Ga0123355_10043220 3300009826 Bacteria 7331
432 Ga0123355_10051846 3300009826 Unclassified 6658
433 Ga0123355_10053771 3300009826 Bacteria 6527
434 Ga0123355_10075115 3300009826 Bacteria 5411
435 Ga0123355_10136704 3300009826 Bacteria 3762
436 Ga0123355_10186389 3300009826 Unclassified 3067
437 Ga0123355_10281938 3300009826 Bacteria 2293
438 Ga0123355_10422692 3300009826 Unclassified 1702
439 Ga0123355_10547595 3300009826 Bacteria 1401
440 Ga0123356_10000863 3300010049 Unclassified 33672
441 Ga0123356_10739740 3300010049 Bacteria 1153
442 Ga0123353_10027300 3300010167 Bacteria 8746
443 Ga0123353_10195494 3300010167 Bacteria 3189
444 Ga0123353_10321614 3300010167 Bacteria 2347
445 Ga0466706_201226 3300042599 Bacteria 15102
446 Ga0466700_156172 3300042600 Bacteria 109805
447 Ga0466707_032868 3300042601 Bacteria 2601
448 Ga0466707_167230 3300042601 Archaea 1190
449 Ga0466707_410729 3300042601 Bacteria 18453
450 Ga0466713_081547 3300042602 Bacteria 50254
451 Ga0466714_010844 3300042603 Bacteria 29148
452 Ga0466714_011989 3300042603 Bacteria 3900
453 Ga0466719_076167 3300042606 Bacteria 7806
454 Ga0466721_079507 3300042608 Bacteria 1721
455 Ga0466722_152830 3300042609 Bacteria 24656
456 IMNBL1DRAFT_c0010499 3300000062 Unclassified 4421
457 JGI24695J34938_10009078 3300002450 Bacteria 5570
458 JGI24700J35501_10922947 3300002508 Bacteria 5056
459 Ga0466733_098872 3300042659 Bacteria 3192
460 Ga0466705_221750 3300042612 Bacteria 1137
461 Ga0466735_133940 3300042624 Bacteria 17814
462 Ga0466704_153580 3300042643 Bacteria 12934
463 Ga0466704_378744 3300042643 Bacteria 2250
464 Ga0466704_602368 3300042643 Bacteria 1124
465 Ga0466705_460116 3300042612 Bacteria 3894
466 Ga0466705_492142 3300042612 Bacteria 2806
467 Ga0466711_008451 3300042615 Bacteria 5417
468 Ga0466711_075435 3300042615 Bacteria 4503
469 Ga0466715_436930 3300042616 Bacteria 3091
470 Ga0466723_040985 3300042618 Bacteria 2113
471 Ga0466723_085628 3300042618 Bacteria 14016
472 Ga0466723_164176 3300042618 Bacteria 29831
473 Ga0466723_271510 3300042618 Bacteria 1448
474 Ga0466726_012209 3300042619 Bacteria 17316

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01680 SOR_SNZ SOR/SNZ family 67 269 0.99
PF05690 ThiG Thiazole biosynthesis protein ThiG 254 316 0.81

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.