Protein Family IF02332
Metagenome
Isolate
371
Members
115
Samples
310
Scaffolds
284.48
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10003714|Ga0123355_100037143
- Length
- 326 aa
- Sequence
- MLRLYKSATRENLAYKNPTCYHPPDKEAYPASYIWRQHMSTTIEKAHTLSEALPYIQRYHGKTMVIKYGGGAMQSDELCRQVIADVVLLSLVGIRVVVVHGGGPEINELLEKIGKEPRFVGGLRYTDAETMEAVQMVLCGKVSKQLAQLIGEQGGKALSLSGMDGRMLVAKKLEAKEDLGFVGQLTVVDPQPINIALAGGYIPVVSTVACGEDPGLMYNINADSAAAKIAVAVGAEKLILLTDVRGILRDPKDETTLIPEVTMADIETLKASGIISGGMIPKVECCAEVVRGGVPRAHILDGRVPHSILIELLSDQGIGTMIHEG*
Sample Types
Isolate
16.4%
Metagenome
83.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
52.2%
Termitidae
23.5%
Kalotermitidae
12.2%
Blattidae
3.5%
Termopsidae
3.5%
Rhinotermitidae
2.6%
Passalidae
1.7%
Hodotermitidae
0.9%
Taxonomy
Archaea
25
Bacteria
325
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 2773857689 | Unclassified Methanomassiliicoccaceae Nt197P3bin8 | Isolate | Unclassified |
| 10 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 11 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 12 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 13 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 14 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 15 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 16 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 17 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 18 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 23 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 24 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 25 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 26 | 2773857684 | Unclassified Methanomassiliicoccaceae Lab288P3bin64 | Isolate | Unclassified |
| 27 | 2773857692 | Unclassified Methanomassiliicoccaceae Th196P3bin2 | Isolate | Unclassified |
| 28 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 29 | 2820581541 | Unclassified Firmicutes Emb289P3bin127 | Isolate | Unclassified |
| 30 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 31 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 37 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 38 | 2773857677 | Methanoplasma sp. Cu122P5bin30 | Isolate | Unclassified |
| 39 | 2773857686 | Unclassified Methanomassiliicoccaceae Lab288P4bin70 | Isolate | Unclassified |
| 40 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 41 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 42 | 2820472365 | Unclassified Firmicutes Lab288P1bin87 | Isolate | Unclassified |
| 43 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 48 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 49 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 50 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 51 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 52 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 53 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 54 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 55 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 56 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 57 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 58 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 59 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 60 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 61 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 62 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 63 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 64 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 65 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 66 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 67 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 68 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 69 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 70 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 71 | 2773857679 | Unclassified Methanomassiliicoccaceae Cu122P4bin8 | Isolate | Unclassified |
| 72 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 73 | 2820296961 | Unclassified Firmicutes Th196P3bin102 | Isolate | Unclassified |
| 74 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 75 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 76 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 77 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 78 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 79 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 80 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 81 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 82 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 83 | 2773857678 | Unclassified Methanomassiliicoccaceae Co191P4bin17 | Isolate | Unclassified |
| 84 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 85 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 86 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 87 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 88 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 89 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 90 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 91 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 92 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 93 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 94 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 95 | 2608642196 | Candidatus Methanoplasma termitum MpT1 | Isolate | Unclassified |
| 96 | 2684622743 | Methanobrevibacter cuticularis DSM11139 | Isolate | Unclassified |
| 97 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 98 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 99 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 100 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 101 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 102 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 103 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 104 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 105 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 106 | 2773857683 | Methanobrevibacter sp. Lab288P3bin120 | Isolate | Unclassified |
| 107 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 108 | 2820558799 | Unclassified Firmicutes Emb289P3bin74 | Isolate | Unclassified |
| 109 | 2820580397 | Unclassified Firmicutes Emb289P3bin133 | Isolate | Unclassified |
| 110 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 111 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 112 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 113 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 114 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 115 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_236420 | 3300042616 | Bacteria | 9123 |
| 2 | Ga0466715_434980 | 3300042616 | Bacteria | 12784 |
| 3 | Ga0466728_340427 | 3300042620 | Unclassified | 2582 |
| 4 | Ga0415639_008996 | 3300038395 | Bacteria | 14279 |
| 5 | Ga0415639_021975 | 3300038395 | Bacteria | 2090 |
| 6 | Ga0415639_030588 | 3300038395 | Bacteria | 5061 |
| 7 | Ga0415639_036772 | 3300038395 | Bacteria | 2551 |
| 8 | Ga0415639_037766 | 3300038395 | Bacteria | 3222 |
| 9 | Ga0466690_035913 | 3300042590 | Bacteria | 8674 |
| 10 | Ga0466693_168319 | 3300042592 | Bacteria | 4226 |
| 11 | Ga0466696_469910 | 3300042596 | Bacteria | 20368 |
| 12 | Ga0123355_10000317 | 3300009826 | Bacteria | 62046 |
| 13 | Ga0123355_10002842 | 3300009826 | Bacteria | 24602 |
| 14 | Ga0123355_10002872 | 3300009826 | Bacteria | 24461 |
| 15 | Ga0123355_10003973 | 3300009826 | Bacteria | 21407 |
| 16 | Ga0123355_10023002 | 3300009826 | Bacteria | 10000 |
| 17 | Ga0123355_10088117 | 3300009826 | Unclassified | 4931 |
| 18 | Ga0123355_10134776 | 3300009826 | Bacteria | 3795 |
| 19 | Ga0123355_10292926 | 3300009826 | Bacteria | 2231 |
| 20 | Ga0123355_10357780 | 3300009826 | Bacteria | 1926 |
| 21 | Ga0123356_10306728 | 3300010049 | Bacteria | 1695 |
| 22 | Ga0123356_10575215 | 3300010049 | Bacteria | 1289 |
| 23 | Ga0123356_10709250 | 3300010049 | Bacteria | 1175 |
| 24 | Ga0123356_10996687 | 3300010049 | Bacteria | 1008 |
| 25 | Ga0123353_10204376 | 3300010167 | Archaea | 3104 |
| 26 | Ga0123353_10321528 | 3300010167 | Bacteria | 2348 |
| 27 | Ga0123353_10511458 | 3300010167 | Bacteria | 1746 |
| 28 | Ga0123354_10126852 | 3300010882 | Unclassified | 3253 |
| 29 | 2227535725 | 2225789004 | Bacteria | 57920 |
| 30 | IMNBL1DRAFT_c0006669 | 3300000062 | Bacteria | 6258 |
| 31 | JGI24695J34938_10016741 | 3300002450 | Bacteria | 3718 |
| 32 | JGI24702J35022_10051998 | 3300002462 | Bacteria | 2183 |
| 33 | Ga0068305_10312139 | 3300005083 | Bacteria | 2030 |
| 34 | Ga0466706_114407 | 3300042599 | Bacteria | 65810 |
| 35 | Ga0466719_092761 | 3300042606 | Bacteria | 5463 |
| 36 | Ga0466722_226079 | 3300042609 | Bacteria | 6959 |
| 37 | Ga0466698_469009 | 3300042610 | Archaea | 3354 |
| 38 | Ga0466730_024878 | 3300042625 | Archaea | 3758 |
| 39 | Ga0466702_066506 | 3300042635 | Bacteria | 1958 |
| 40 | Ga0466703_100800 | 3300042636 | Unclassified | 1608 |
| 41 | Ga0466727_051819 | 3300042655 | Bacteria | 3198 |
| 42 | Ga0466705_294101 | 3300042612 | Bacteria | 23963 |
| 43 | Ga0466705_392054 | 3300042612 | Bacteria | 26687 |
| 44 | Ga0466705_420380 | 3300042612 | Bacteria | 591368 |
| 45 | Ga0466705_467086 | 3300042612 | Bacteria | 6794 |
| 46 | Ga0466711_133822 | 3300042615 | Bacteria | 45887 |
| 47 | Ga0466715_278580 | 3300042616 | Bacteria | 22056 |
| 48 | Ga0466726_092357 | 3300042619 | Bacteria | 1615 |
| 49 | Ga0466726_198719 | 3300042619 | Bacteria | 2078 |
| 50 | Ga0466726_343996 | 3300042619 | Bacteria | 1798 |
| 51 | Ga0415639_001177 | 3300038395 | Bacteria | 20237 |
| 52 | Ga0466690_371783 | 3300042590 | Bacteria | 7399 |
| 53 | Ga0466696_017010 | 3300042596 | Bacteria | 44421 |
| 54 | Ga0123355_10000657 | 3300009826 | Bacteria | 46911 |
| 55 | Ga0123355_10007338 | 3300009826 | Bacteria | 16506 |
| 56 | Ga0123355_10009094 | 3300009826 | Bacteria | 15062 |
| 57 | Ga0123355_10072786 | 3300009826 | Bacteria | 5510 |
| 58 | Ga0123355_10090621 | 3300009826 | Bacteria | 4850 |
| 59 | Ga0123355_10223748 | 3300009826 | Bacteria | 2701 |
| 60 | Ga0123355_10339847 | 3300009826 | Bacteria | 2001 |
| 61 | Ga0123355_10599366 | 3300009826 | Bacteria | 1308 |
| 62 | Ga0123355_10786175 | 3300009826 | Bacteria | 1065 |
| 63 | Ga0123356_10036270 | 3300010049 | Bacteria | 4605 |
| 64 | Ga0123353_10380978 | 3300010167 | Bacteria | 2109 |
| 65 | IMNBL1DRAFT_c0008444 | 3300000062 | Bacteria | 5239 |
| 66 | JGI24702J35022_10012340 | 3300002462 | Bacteria | 4753 |
| 67 | JGI24702J35022_10028533 | 3300002462 | Unclassified | 2998 |
| 68 | Ga0466713_026999 | 3300042602 | Bacteria | 24173 |
| 69 | Ga0466731_132588 | 3300042622 | Archaea | 4538 |
| 70 | Ga0466735_153199 | 3300042624 | Bacteria | 1985 |
| 71 | Ga0466703_337152 | 3300042636 | Archaea | 36868 |
| 72 | Ga0466704_006947 | 3300042643 | Unclassified | 7837 |
| 73 | Ga0466704_473559 | 3300042643 | Bacteria | 7072 |
| 74 | Ga0466709_099490 | 3300042648 | Bacteria | 55837 |
| 75 | Ga0466705_295013 | 3300042612 | Bacteria | 3838 |
| 76 | Ga0466715_473519 | 3300042616 | Bacteria | 25916 |
| 77 | Ga0466728_056681 | 3300042620 | Bacteria | 3819 |
| 78 | Ga0466728_322410 | 3300042620 | Bacteria | 5863 |
| 79 | Ga0415639_075265 | 3300038395 | Bacteria | 5176 |
| 80 | Ga0415639_190039 | 3300038395 | Bacteria | 1240 |
| 81 | Ga0466693_264817 | 3300042592 | Bacteria | 1104 |
| 82 | Ga0466691_036429 | 3300042593 | Bacteria | 1394 |
| 83 | Ga0123357_10005154 | 3300009784 | Archaea | 15591 |
| 84 | Ga0123355_10000616 | 3300009826 | Bacteria | 48098 |
| 85 | Ga0123355_10000745 | 3300009826 | Bacteria | 44393 |
| 86 | Ga0123355_10085108 | 3300009826 | Bacteria | 5033 |
| 87 | Ga0123355_10302761 | 3300009826 | Bacteria | 2177 |
| 88 | Ga0123355_10598644 | 3300009826 | Bacteria | 1309 |
| 89 | Ga0123356_10027923 | 3300010049 | Bacteria | 5289 |
| 90 | Ga0123356_10473388 | 3300010049 | Bacteria | 1404 |
| 91 | Ga0123353_10000031 | 3300010167 | Bacteria | 160211 |
| 92 | Ga0123353_10026541 | 3300010167 | Bacteria | 8850 |
| 93 | Ga0123353_10039774 | 3300010167 | Bacteria | 7408 |
| 94 | Ga0123353_10093212 | 3300010167 | Bacteria | 4852 |
| 95 | Ga0123353_10832602 | 3300010167 | Bacteria | 1268 |
| 96 | Ga0123353_11168082 | 3300010167 | Bacteria | 1014 |
| 97 | Ga0123354_10328612 | 3300010882 | Bacteria | 1398 |
| 98 | IMNBL1DRAFT_c0003282 | 3300000062 | Bacteria | 10532 |
| 99 | IMNBL1DRAFT_c0015880 | 3300000062 | Bacteria | 3245 |
| 100 | IMNBL1DRAFT_c0043113 | 3300000062 | Bacteria | 1496 |
| 101 | JGI24695J34938_10001283 | 3300002450 | Bacteria | 22012 |
| 102 | JGI24695J34938_10011709 | 3300002450 | Bacteria | 4707 |
| 103 | JGI24703J35330_11748073 | 3300002501 | Bacteria | 10406 |
| 104 | JGI24703J35330_11748800 | 3300002501 | Bacteria | 37583 |
| 105 | JGI24705J35276_12226002 | 3300002504 | Bacteria | 2797 |
| 106 | Ga0466706_018017 | 3300042599 | Bacteria | 65893 |
| 107 | Ga0466700_362180 | 3300042600 | Unclassified | 1333 |
| 108 | Ga0466707_027792 | 3300042601 | Bacteria | 45003 |
| 109 | Ga0466707_039345 | 3300042601 | Bacteria | 21785 |
| 110 | Ga0466707_066423 | 3300042601 | Bacteria | 22093 |
| 111 | Ga0466707_200198 | 3300042601 | Bacteria | 7294 |
| 112 | Ga0466713_123319 | 3300042602 | Bacteria | 44734 |
| 113 | Ga0466716_439171 | 3300042605 | Bacteria | 6035 |
| 114 | Ga0466721_083890 | 3300042608 | Bacteria | 14499 |
| 115 | Ga0466729_310072 | 3300042621 | Bacteria | 3036 |
| 116 | Ga0466734_152521 | 3300042623 | Bacteria | 1155 |
| 117 | Ga0466704_604508 | 3300042643 | Bacteria | 96670 |
| 118 | Ga0466708_005887 | 3300042652 | Bacteria | 23308 |
| 119 | Ga0466725_276729 | 3300042654 | Bacteria | 1129 |
| 120 | Ga0466727_016986 | 3300042655 | Bacteria | 15769 |
| 121 | Ga0466711_385489 | 3300042615 | Bacteria | 10641 |
| 122 | Ga0466729_102311 | 3300042621 | Bacteria | 30153 |
| 123 | Ga0415639_001178 | 3300038395 | Bacteria | 47687 |
| 124 | Ga0466693_033031 | 3300042592 | Bacteria | 2509 |
| 125 | Ga0123355_10001034 | 3300009826 | Bacteria | 38531 |
| 126 | Ga0123355_10016607 | 3300009826 | Bacteria | 11612 |
| 127 | Ga0123355_10056507 | 3300009826 | Bacteria | 6350 |
| 128 | Ga0123355_10059945 | 3300009826 | Bacteria | 6146 |
| 129 | Ga0123355_10063198 | 3300009826 | Unclassified | 5971 |
| 130 | Ga0123355_10133162 | 3300009826 | Bacteria | 3825 |
| 131 | Ga0123355_10218519 | 3300009826 | Bacteria | 2746 |
| 132 | Ga0123355_10528203 | 3300009826 | Bacteria | 1439 |
| 133 | Ga0123356_10000376 | 3300010049 | Bacteria | 50874 |
| 134 | Ga0123356_10028839 | 3300010049 | Unclassified | 5202 |
| 135 | Ga0123356_10079727 | 3300010049 | Bacteria | 3093 |
| 136 | Ga0123356_10386742 | 3300010049 | Bacteria | 1533 |
| 137 | Ga0123356_10801161 | 3300010049 | Bacteria | 1113 |
| 138 | Ga0123353_10034389 | 3300010167 | Bacteria | 7908 |
| 139 | JGI24702J35022_10092917 | 3300002462 | Bacteria | 1644 |
| 140 | JGI24703J35330_11748104 | 3300002501 | Bacteria | 10698 |
| 141 | JGI24705J35276_12228881 | 3300002504 | Bacteria | 3279 |
| 142 | JGI24700J35501_10926619 | 3300002508 | Bacteria | 6360 |
| 143 | JGI24696J40584_12960369 | 3300002834 | Archaea | 7039 |
| 144 | Ga0072940_1053459 | 3300005200 | Bacteria | 1819 |
| 145 | Ga0466706_145133 | 3300042599 | Bacteria | 2013 |
| 146 | Ga0466706_158253 | 3300042599 | Bacteria | 74693 |
| 147 | Ga0466706_283999 | 3300042599 | Archaea | 2270 |
| 148 | Ga0466707_029475 | 3300042601 | Bacteria | 25235 |
| 149 | Ga0466714_009017 | 3300042603 | Bacteria | 1442 |
| 150 | Ga0466714_044972 | 3300042603 | Bacteria | 1224 |
| 151 | Ga0466714_066299 | 3300042603 | Bacteria | 12983 |
| 152 | Ga0466716_024070 | 3300042605 | Bacteria | 10307 |
| 153 | Ga0466734_022292 | 3300042623 | Archaea | 11815 |
| 154 | Ga0466735_015321 | 3300042624 | Bacteria | 42913 |
| 155 | Ga0466702_286324 | 3300042635 | Bacteria | 84451 |
| 156 | Ga0466704_157992 | 3300042643 | Bacteria | 1297 |
| 157 | Ga0466704_466232 | 3300042643 | Unclassified | 4263 |
| 158 | Ga0466725_042814 | 3300042654 | Bacteria | 2247 |
| 159 | Ga0466733_028144 | 3300042659 | Bacteria | 1874 |
| 160 | Ga0466723_040535 | 3300042618 | Bacteria | 6167 |
| 161 | Ga0415639_033282 | 3300038395 | Bacteria | 6029 |
| 162 | Ga0415639_102343 | 3300038395 | Bacteria | 1245 |
| 163 | Ga0466656_235393 | 3300042550 | Bacteria | 1002 |
| 164 | Ga0123357_10287073 | 3300009784 | Bacteria | 1688 |
| 165 | Ga0123355_10000112 | 3300009826 | Bacteria | 91039 |
| 166 | Ga0123355_10010432 | 3300009826 | Bacteria | 14239 |
| 167 | Ga0123355_10012730 | 3300009826 | Unclassified | 13043 |
| 168 | Ga0123355_10020166 | 3300009826 | Bacteria | 10637 |
| 169 | Ga0123355_10029955 | 3300009826 | Bacteria | 8818 |
| 170 | Ga0123355_10055369 | 3300009826 | Bacteria | 6423 |
| 171 | Ga0123355_10112626 | 3300009826 | Bacteria | 4246 |
| 172 | Ga0123355_10282497 | 3300009826 | Bacteria | 2289 |
| 173 | Ga0123355_10519468 | 3300009826 | Bacteria | 1458 |
| 174 | Ga0123356_10000812 | 3300010049 | Bacteria | 34713 |
| 175 | Ga0123356_10028411 | 3300010049 | Archaea | 5240 |
| 176 | Ga0123356_10422936 | 3300010049 | Bacteria | 1475 |
| 177 | Ga0123353_10017156 | 3300010167 | Bacteria | 10623 |
| 178 | Ga0123353_10145160 | 3300010167 | Bacteria | 3795 |
| 179 | Ga0123353_10208691 | 3300010167 | Archaea | 3065 |
| 180 | Ga0123353_10257131 | 3300010167 | Unclassified | 2700 |
| 181 | Ga0123353_10564076 | 3300010167 | Bacteria | 1638 |
| 182 | Ga0123354_10263464 | 3300010882 | Unclassified | 1715 |
| 183 | 2227150240 | 2225789004 | Bacteria | 8572 |
| 184 | IMNBL1DRAFT_c0000292 | 3300000062 | Bacteria | 43151 |
| 185 | Ga0466707_254889 | 3300042601 | Bacteria | 95649 |
| 186 | Ga0466707_337195 | 3300042601 | Bacteria | 10636 |
| 187 | Ga0466707_388797 | 3300042601 | Bacteria | 125790 |
| 188 | Ga0466714_067885 | 3300042603 | Bacteria | 1088 |
| 189 | Ga0466703_005585 | 3300042636 | Bacteria | 7181 |
| 190 | Ga0466703_309212 | 3300042636 | Bacteria | 185748 |
| 191 | Ga0466704_200566 | 3300042643 | Bacteria | 4761 |
| 192 | Ga0466704_417266 | 3300042643 | Bacteria | 120388 |
| 193 | Ga0466704_485442 | 3300042643 | Bacteria | 2087 |
| 194 | Ga0466705_168520 | 3300042612 | Bacteria | 25186 |
| 195 | Ga0466733_183530 | 3300042659 | Bacteria | 1782 |
| 196 | Ga0466705_423666 | 3300042612 | Unclassified | 6525 |
| 197 | Ga0466711_043514 | 3300042615 | Unclassified | 3309 |
| 198 | Ga0466715_231026 | 3300042616 | Bacteria | 16469 |
| 199 | Ga0466723_050785 | 3300042618 | Bacteria | 18827 |
| 200 | Ga0466726_466667 | 3300042619 | Bacteria | 36135 |
| 201 | Ga0415639_014104 | 3300038395 | Bacteria | 18695 |
| 202 | Ga0415639_029431 | 3300038395 | Bacteria | 1463 |
| 203 | Ga0466693_400648 | 3300042592 | Archaea | 3835 |
| 204 | Ga0466691_128944 | 3300042593 | Bacteria | 3454 |
| 205 | Ga0123357_10464825 | 3300009784 | Archaea | 1084 |
| 206 | Ga0123355_10001544 | 3300009826 | Bacteria | 32121 |
| 207 | Ga0123355_10003110 | 3300009826 | Bacteria | 23681 |
| 208 | Ga0123355_10003714 | 3300009826 | Bacteria | 22024 |
| 209 | Ga0123355_10005648 | 3300009826 | Bacteria | 18363 |
| 210 | Ga0123355_10009664 | 3300009826 | Bacteria | 14696 |
| 211 | Ga0123355_10099144 | 3300009826 | Bacteria | 4592 |
| 212 | Ga0123355_10183353 | 3300009826 | Unclassified | 3102 |
| 213 | Ga0123355_10449729 | 3300009826 | Bacteria | 1624 |
| 214 | Ga0123353_10000266 | 3300010167 | Bacteria | 65359 |
| 215 | Ga0123353_10511925 | 3300010167 | Bacteria | 1745 |
| 216 | 2227386342 | 2225789004 | Bacteria | 27546 |
| 217 | JGI24702J35022_10029051 | 3300002462 | Unclassified | 2968 |
| 218 | Ga0466700_111127 | 3300042600 | Bacteria | 1523 |
| 219 | Ga0466707_015396 | 3300042601 | Bacteria | 44812 |
| 220 | Ga0466713_107223 | 3300042602 | Bacteria | 15933 |
| 221 | Ga0466713_120355 | 3300042602 | Bacteria | 20022 |
| 222 | Ga0466714_017497 | 3300042603 | Bacteria | 23491 |
| 223 | Ga0466714_109735 | 3300042603 | Bacteria | 1615 |
| 224 | Ga0466714_145697 | 3300042603 | Bacteria | 1269 |
| 225 | Ga0466719_214125 | 3300042606 | Bacteria | 5958 |
| 226 | Ga0466722_014813 | 3300042609 | Bacteria | 8778 |
| 227 | Ga0466722_202273 | 3300042609 | Bacteria | 1352 |
| 228 | Ga0466704_164996 | 3300042643 | Bacteria | 22338 |
| 229 | Ga0466704_421891 | 3300042643 | Bacteria | 1636 |
| 230 | Ga0466709_191799 | 3300042648 | Bacteria | 11485 |
| 231 | Ga0466708_153774 | 3300042652 | Bacteria | 58323 |
| 232 | Ga0466708_430891 | 3300042652 | Bacteria | 1091 |
| 233 | Ga0466705_242080 | 3300042612 | Bacteria | 10494 |
| 234 | Ga0466705_323502 | 3300042612 | Unclassified | 2497 |
| 235 | Ga0466715_206410 | 3300042616 | Bacteria | 29967 |
| 236 | Ga0466723_100233 | 3300042618 | Bacteria | 14061 |
| 237 | Ga0466723_143929 | 3300042618 | Bacteria | 2873 |
| 238 | Ga0415639_005747 | 3300038395 | Bacteria | 29446 |
| 239 | Ga0415639_034254 | 3300038395 | Bacteria | 5136 |
| 240 | Ga0415639_042596 | 3300038395 | Bacteria | 16506 |
| 241 | Ga0415639_089316 | 3300038395 | Bacteria | 4313 |
| 242 | Ga0466693_275469 | 3300042592 | Bacteria | 2832 |
| 243 | Ga0466699_232799 | 3300042597 | Bacteria | 2135 |
| 244 | Ga0123355_10004670 | 3300009826 | Bacteria | 19950 |
| 245 | Ga0123355_10034405 | 3300009826 | Bacteria | 8233 |
| 246 | Ga0123355_10063757 | 3300009826 | Bacteria | 5941 |
| 247 | Ga0123355_10069099 | 3300009826 | Bacteria | 5679 |
| 248 | Ga0123355_10199065 | 3300009826 | Bacteria | 2931 |
| 249 | Ga0123353_10168103 | 3300010167 | Bacteria | 3484 |
| 250 | Ga0123353_10322899 | 3300010167 | Bacteria | 2342 |
| 251 | Ga0123353_10402590 | 3300010167 | Bacteria | 2036 |
| 252 | Ga0123353_10405532 | 3300010167 | Bacteria | 2027 |
| 253 | Ga0123353_10564099 | 3300010167 | Bacteria | 1638 |
| 254 | Ga0123353_10585650 | 3300010167 | Bacteria | 1599 |
| 255 | Ga0123353_11367998 | 3300010167 | Bacteria | 913 |
| 256 | IMNBL1DRAFT_c0000003 | 3300000062 | Bacteria | 275310 |
| 257 | Ga0068302_10023118 | 3300005071 | Bacteria | 7154 |
| 258 | Ga0068305_10096953 | 3300005083 | Bacteria | 6356 |
| 259 | Ga0466706_079559 | 3300042599 | Bacteria | 12980 |
| 260 | Ga0466706_224823 | 3300042599 | Bacteria | 3164 |
| 261 | Ga0466700_059475 | 3300042600 | Bacteria | 2585 |
| 262 | Ga0466707_208676 | 3300042601 | Bacteria | 5741 |
| 263 | Ga0466707_404102 | 3300042601 | Bacteria | 31189 |
| 264 | Ga0466702_253789 | 3300042635 | Unclassified | 1038 |
| 265 | Ga0466703_323818 | 3300042636 | Bacteria | 3541 |
| 266 | Ga0466705_124609 | 3300042612 | Bacteria | 89342 |
| 267 | Ga0466705_377825 | 3300042612 | Bacteria | 346954 |
| 268 | Ga0466718_073225 | 3300042617 | Archaea | 4167 |
| 269 | Ga0466726_131866 | 3300042619 | Bacteria | 26257 |
| 270 | Ga0466726_258177 | 3300042619 | Unclassified | 11214 |
| 271 | Ga0466726_417658 | 3300042619 | Bacteria | 4150 |
| 272 | Ga0466728_028830 | 3300042620 | Bacteria | 8411 |
| 273 | Ga0466728_052681 | 3300042620 | Bacteria | 18370 |
| 274 | Ga0466692_182511 | 3300042591 | Bacteria | 11942 |
| 275 | Ga0466693_417289 | 3300042592 | Bacteria | 1318 |
| 276 | Ga0123355_10001998 | 3300009826 | Bacteria | 28797 |
| 277 | Ga0123355_10008095 | 3300009826 | Bacteria | 15863 |
| 278 | Ga0123355_10047590 | 3300009826 | Bacteria | 6973 |
| 279 | Ga0123355_10092442 | 3300009826 | Bacteria | 4792 |
| 280 | Ga0123355_10105197 | 3300009826 | Bacteria | 4429 |
| 281 | Ga0123355_10208845 | 3300009826 | Bacteria | 2835 |
| 282 | Ga0123355_10296070 | 3300009826 | Bacteria | 2213 |
| 283 | Ga0123355_10430516 | 3300009826 | Bacteria | 1678 |
| 284 | Ga0123356_10222021 | 3300010049 | Bacteria | 1947 |
| 285 | Ga0123356_10426590 | 3300010049 | Bacteria | 1469 |
| 286 | Ga0123353_10008983 | 3300010167 | Bacteria | 13727 |
| 287 | Ga0123353_10012740 | 3300010167 | Bacteria | 11988 |
| 288 | Ga0123353_10079382 | 3300010167 | Bacteria | 5275 |
| 289 | IMNBL1DRAFT_c0004403 | 3300000062 | Bacteria | 8488 |
| 290 | JGI24702J35022_10000649 | 3300002462 | Bacteria | 21152 |
| 291 | JGI24703J35330_11748650 | 3300002501 | Bacteria | 23499 |
| 292 | Ga0466706_037807 | 3300042599 | Bacteria | 8874 |
| 293 | Ga0466706_098272 | 3300042599 | Unclassified | 8715 |
| 294 | Ga0466706_103234 | 3300042599 | Bacteria | 11904 |
| 295 | Ga0466706_281829 | 3300042599 | Bacteria | 79600 |
| 296 | Ga0466707_094283 | 3300042601 | Bacteria | 15024 |
| 297 | Ga0466707_144421 | 3300042601 | Bacteria | 29741 |
| 298 | Ga0466707_225054 | 3300042601 | Bacteria | 3253 |
| 299 | Ga0466707_228204 | 3300042601 | Bacteria | 4707 |
| 300 | Ga0466707_408159 | 3300042601 | Bacteria | 1005 |
| 301 | Ga0466714_007449 | 3300042603 | Bacteria | 9992 |
| 302 | Ga0466714_084521 | 3300042603 | Bacteria | 5640 |
| 303 | Ga0466719_112179 | 3300042606 | Bacteria | 5399 |
| 304 | Ga0466721_194172 | 3300042608 | Bacteria | 1513 |
| 305 | Ga0466721_379319 | 3300042608 | Bacteria | 2150 |
| 306 | Ga0466734_028713 | 3300042623 | Archaea | 3394 |
| 307 | Ga0466703_194599 | 3300042636 | Bacteria | 18214 |
| 308 | Ga0466703_341913 | 3300042636 | Bacteria | 13824 |
| 309 | Ga0466704_497263 | 3300042643 | Bacteria | 45901 |
| 310 | Ga0466725_322276 | 3300042654 | Bacteria | 1046 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00696 | AA_kinase | Amino acid kinase family | 62 | 301 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.