Protein Family IF02247
Metagenome
Isolate
278
Members
75
Samples
243
Scaffolds
300.35
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10295044|Ga0123357_102950441
- Length
- 347 aa
- Sequence
- MAGSRFWISWINCILRHRINQNGFTGGGFLSASGISFSREGKPMPKSRRKSTFTRELPLYIMIIPAVVLTAIYSYGPMLGLIMSFQNFKLTGGWFGSPFIGMQNFVRIFTMQNIGDIMRNTIVLSVAKMIGGIVVPVIFALLLNEVMQKFYKRTVQTFVYLPNFLSWVILAGVFRDILSPSTGIVNHLLGYIGVKPIYFLGNTTWFPITMIITAIWQGFGFSSVIYLASLNGIDPGLYESAEIDGAGRWKQTLHITLPGLTSIIILMSVLSLGNILNGGFDQIFNMYNPAVMKTGDILDTLVYRLGIGNAQYSLATAAGLFKSLVSLIFIVASYYLADRVAGYKIF*
Sample Types
Isolate
12.6%
Metagenome
87.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
30.9%
Kalotermitidae
20.6%
Blattidae
13.2%
Unclassified
11.8%
Armadillidiidae
5.9%
Termopsidae
4.4%
Rhinotermitidae
4.4%
Scarabaeidae
2.9%
Apidae
1.5%
Hodotermitidae
1.5%
Noctuidae
1.5%
Drosophilidae
1.5%
Taxonomy
Archaea
1
Bacteria
253
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 2 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 11 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 12 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 13 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 14 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 15 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 20 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 21 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 24 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 25 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 26 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 34 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 39 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 44 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 45 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 46 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 47 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 48 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 49 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 51 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 52 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 53 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 54 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 55 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 56 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 57 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 58 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 59 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 60 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 61 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 62 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 63 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 64 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 65 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 66 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 67 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 68 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 69 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 70 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 71 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 72 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 73 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 74 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 75 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_301670 | 3300042612 | Bacteria | 12661 |
| 2 | Ga0123357_10110329 | 3300009784 | Bacteria | 3510 |
| 3 | Ga0123356_10017203 | 3300010049 | Bacteria | 6881 |
| 4 | Ga0123353_10125301 | 3300010167 | Bacteria | 4128 |
| 5 | Ga0123353_10249089 | 3300010167 | Bacteria | 2753 |
| 6 | Ga0466703_250868 | 3300042636 | Bacteria | 5735 |
| 7 | Ga0466703_401474 | 3300042636 | Bacteria | 2597 |
| 8 | Ga0466704_032670 | 3300042643 | Unclassified | 6418 |
| 9 | Ga0466704_330695 | 3300042643 | Bacteria | 6412 |
| 10 | Ga0466704_342594 | 3300042643 | Bacteria | 6395 |
| 11 | Ga0466727_336030 | 3300042655 | Bacteria | 2227 |
| 12 | Ga0415639_203041 | 3300038395 | Bacteria | 1962 |
| 13 | Ga0466690_413170 | 3300042590 | Bacteria | 8717 |
| 14 | Ga0466693_163228 | 3300042592 | Bacteria | 2437 |
| 15 | Ga0466691_018065 | 3300042593 | Bacteria | 1561 |
| 16 | Ga0466696_074105 | 3300042596 | Bacteria | 5624 |
| 17 | Ga0466696_129279 | 3300042596 | Bacteria | 2155 |
| 18 | Ga0466711_115526 | 3300042615 | Bacteria | 5313 |
| 19 | Ga0466711_492951 | 3300042615 | Bacteria | 1289 |
| 20 | Ga0466726_204965 | 3300042619 | Bacteria | 5162 |
| 21 | Ga0466728_109639 | 3300042620 | Bacteria | 5809 |
| 22 | Ga0466721_370479 | 3300042608 | Bacteria | 1845 |
| 23 | Ga0466698_245620 | 3300042610 | Archaea | 3184 |
| 24 | Ga0466697_179651 | 3300042611 | Bacteria | 3156 |
| 25 | Ga0466705_091019 | 3300042612 | Bacteria | 2953 |
| 26 | Ga0466705_353488 | 3300042612 | Bacteria | 7133 |
| 27 | Ga0466727_350459 | 3300042655 | Bacteria | 2240 |
| 28 | Ga0123356_10064033 | 3300010049 | Bacteria | 3437 |
| 29 | Ga0123353_10147116 | 3300010167 | Bacteria | 3766 |
| 30 | Ga0123353_10262216 | 3300010167 | Unclassified | 2668 |
| 31 | Ga0123353_10357346 | 3300010167 | Bacteria | 2197 |
| 32 | Ga0123354_10071999 | 3300010882 | Bacteria | 4982 |
| 33 | Ga0160465_101705 | 3300012803 | Bacteria | 5871 |
| 34 | Ga0160466_100526 | 3300012809 | Bacteria | 18640 |
| 35 | Ga0466703_223765 | 3300042636 | Bacteria | 7128 |
| 36 | Ga0466704_006369 | 3300042643 | Unclassified | 4971 |
| 37 | Ga0160452_100212 | 3300012834 | Bacteria | 61588 |
| 38 | Ga0466705_499480 | 3300042612 | Bacteria | 5598 |
| 39 | Ga0466715_191381 | 3300042616 | Bacteria | 9442 |
| 40 | Ga0466726_284049 | 3300042619 | Bacteria | 2525 |
| 41 | Ga0466728_163537 | 3300042620 | Bacteria | 10102 |
| 42 | Ga0466728_355106 | 3300042620 | Bacteria | 4092 |
| 43 | Ga0466728_391895 | 3300042620 | Bacteria | 3900 |
| 44 | Ga0466706_284454 | 3300042599 | Bacteria | 6405 |
| 45 | Ga0466707_255549 | 3300042601 | Bacteria | 6110 |
| 46 | Ga0466721_195407 | 3300042608 | Bacteria | 2666 |
| 47 | JGI24702J35022_10102795 | 3300002462 | Bacteria | 1566 |
| 48 | Ga0466705_101139 | 3300042612 | Bacteria | 45694 |
| 49 | Ga0466705_124252 | 3300042612 | Bacteria | 6694 |
| 50 | Ga0466705_218906 | 3300042612 | Bacteria | 7829 |
| 51 | Ga0466733_040796 | 3300042659 | Bacteria | 3610 |
| 52 | Ga0123357_10029824 | 3300009784 | Bacteria | 7395 |
| 53 | Ga0123356_10344575 | 3300010049 | Bacteria | 1612 |
| 54 | Ga0123353_10104624 | 3300010167 | Bacteria | 4561 |
| 55 | Ga0123353_10122187 | 3300010167 | Bacteria | 4185 |
| 56 | Ga0123353_10168251 | 3300010167 | Bacteria | 3482 |
| 57 | Ga0160464_101740 | 3300012805 | Bacteria | 6018 |
| 58 | Ga0466703_411987 | 3300042636 | Bacteria | 8964 |
| 59 | Ga0466704_474076 | 3300042643 | Unclassified | 1271 |
| 60 | Ga0466708_283375 | 3300042652 | Bacteria | 10282 |
| 61 | Ga0160453_100211 | 3300012814 | Bacteria | 56714 |
| 62 | Ga0160452_100171 | 3300012834 | Bacteria | 73091 |
| 63 | Ga0466696_388409 | 3300042596 | Bacteria | 3041 |
| 64 | Ga0466715_483723 | 3300042616 | Bacteria | 20509 |
| 65 | Ga0466718_141612 | 3300042617 | Bacteria | 1759 |
| 66 | Ga0466723_347004 | 3300042618 | Bacteria | 2165 |
| 67 | Ga0466726_149705 | 3300042619 | Bacteria | 8033 |
| 68 | Ga0466707_047699 | 3300042601 | Bacteria | 2435 |
| 69 | Ga0466707_178363 | 3300042601 | Bacteria | 2111 |
| 70 | Ga0466719_041829 | 3300042606 | Bacteria | 3009 |
| 71 | Ga0466719_304188 | 3300042606 | Unclassified | 1440 |
| 72 | Ga0466722_143148 | 3300042609 | Bacteria | 1369 |
| 73 | Ga0466722_225339 | 3300042609 | Bacteria | 5723 |
| 74 | JGI24702J35022_10001314 | 3300002462 | Unclassified | 15460 |
| 75 | Ga0068302_10245741 | 3300005071 | Bacteria | 2574 |
| 76 | Ga0068305_10001799 | 3300005083 | Bacteria | 51560 |
| 77 | Ga0466705_139021 | 3300042612 | Bacteria | 4229 |
| 78 | Ga0123357_10295044 | 3300009784 | Bacteria | 1648 |
| 79 | Ga0123355_10002755 | 3300009826 | Bacteria | 24925 |
| 80 | Ga0123353_10098096 | 3300010167 | Bacteria | 4723 |
| 81 | Ga0123353_10321884 | 3300010167 | Bacteria | 2346 |
| 82 | Ga0123353_10923728 | 3300010167 | Bacteria | 1184 |
| 83 | Ga0466704_000075 | 3300042643 | Unclassified | 1532 |
| 84 | Ga0466704_055884 | 3300042643 | Bacteria | 73215 |
| 85 | Ga0466704_074771 | 3300042643 | Bacteria | 86016 |
| 86 | Ga0466709_028738 | 3300042648 | Bacteria | 12344 |
| 87 | Ga0466708_160479 | 3300042652 | Bacteria | 3506 |
| 88 | Ga0466708_261347 | 3300042652 | Bacteria | 4574 |
| 89 | Ga0466727_255750 | 3300042655 | Bacteria | 3833 |
| 90 | Ga0415639_076784 | 3300038395 | Bacteria | 3618 |
| 91 | Ga0415639_132794 | 3300038395 | Bacteria | 3906 |
| 92 | Ga0466692_028011 | 3300042591 | Unclassified | 4125 |
| 93 | Ga0466692_175001 | 3300042591 | Bacteria | 9009 |
| 94 | Ga0466696_219688 | 3300042596 | Unclassified | 4856 |
| 95 | Ga0466705_460944 | 3300042612 | Bacteria | 10515 |
| 96 | Ga0466711_168556 | 3300042615 | Bacteria | 55422 |
| 97 | Ga0466715_066467 | 3300042616 | Bacteria | 6711 |
| 98 | Ga0466715_090359 | 3300042616 | Bacteria | 10341 |
| 99 | Ga0466726_273781 | 3300042619 | Unclassified | 3409 |
| 100 | Ga0466728_418982 | 3300042620 | Bacteria | 3729 |
| 101 | Ga0466719_444355 | 3300042606 | Unclassified | 1817 |
| 102 | JGI24703J35330_11748860 | 3300002501 | Bacteria | 57330 |
| 103 | Ga0072941_1158099 | 3300005201 | Bacteria | 3628 |
| 104 | Ga0466705_321269 | 3300042612 | Unclassified | 11090 |
| 105 | Ga0466727_351759 | 3300042655 | Bacteria | 4377 |
| 106 | Ga0123355_10270889 | 3300009826 | Bacteria | 2359 |
| 107 | Ga0123356_10036784 | 3300010049 | Bacteria | 4570 |
| 108 | Ga0123353_10118630 | 3300010167 | Bacteria | 4255 |
| 109 | Ga0123353_10169391 | 3300010167 | Bacteria | 3468 |
| 110 | Ga0123353_10480463 | 3300010167 | Bacteria | 1818 |
| 111 | Ga0160464_101069 | 3300012805 | Bacteria | 12209 |
| 112 | Ga0466703_007520 | 3300042636 | Bacteria | 1303 |
| 113 | Ga0466703_226192 | 3300042636 | Bacteria | 63543 |
| 114 | Ga0466704_021013 | 3300042643 | Bacteria | 14867 |
| 115 | Ga0466708_445182 | 3300042652 | Unclassified | 2139 |
| 116 | Ga0160443_101113 | 3300012848 | Bacteria | 10770 |
| 117 | Ga0415639_116337 | 3300038395 | Bacteria | 2948 |
| 118 | Ga0466656_044816 | 3300042550 | Bacteria | 1761 |
| 119 | Ga0466690_069156 | 3300042590 | Unclassified | 3678 |
| 120 | Ga0466690_167849 | 3300042590 | Bacteria | 3385 |
| 121 | Ga0466692_064941 | 3300042591 | Bacteria | 2887 |
| 122 | Ga0466696_238847 | 3300042596 | Bacteria | 2134 |
| 123 | Ga0466696_258334 | 3300042596 | Bacteria | 4164 |
| 124 | Ga0466696_351761 | 3300042596 | Bacteria | 1508 |
| 125 | Ga0466711_507136 | 3300042615 | Bacteria | 2776 |
| 126 | Ga0466715_157417 | 3300042616 | Bacteria | 7883 |
| 127 | Ga0466715_513990 | 3300042616 | Bacteria | 111655 |
| 128 | Ga0466723_058607 | 3300042618 | Bacteria | 5136 |
| 129 | Ga0466723_152995 | 3300042618 | Bacteria | 3523 |
| 130 | Ga0466726_160866 | 3300042619 | Bacteria | 3323 |
| 131 | Ga0466726_198086 | 3300042619 | Bacteria | 1370 |
| 132 | Ga0466726_313492 | 3300042619 | Bacteria | 1165 |
| 133 | Ga0466707_380911 | 3300042601 | Bacteria | 1573 |
| 134 | Ga0466716_522905 | 3300042605 | Unclassified | 7898 |
| 135 | JGI24702J35022_10019433 | 3300002462 | Bacteria | 3695 |
| 136 | JGI24702J35022_10019481 | 3300002462 | Unclassified | 3690 |
| 137 | Ga0466705_025443 | 3300042612 | Unclassified | 3909 |
| 138 | Ga0466705_123307 | 3300042612 | Bacteria | 12557 |
| 139 | Ga0466705_190142 | 3300042612 | Bacteria | 11692 |
| 140 | Ga0466705_243985 | 3300042612 | Bacteria | 6160 |
| 141 | Ga0466705_245661 | 3300042612 | Bacteria | 2941 |
| 142 | Ga0466733_106325 | 3300042659 | Bacteria | 3795 |
| 143 | Ga0123356_10014725 | 3300010049 | Bacteria | 7514 |
| 144 | Ga0123356_10371130 | 3300010049 | Bacteria | 1561 |
| 145 | Ga0123356_10569586 | 3300010049 | Bacteria | 1295 |
| 146 | Ga0123353_10437930 | 3300010167 | Bacteria | 1929 |
| 147 | Ga0160465_101167 | 3300012803 | Bacteria | 8263 |
| 148 | Ga0466703_136127 | 3300042636 | Bacteria | 4927 |
| 149 | Ga0466704_153867 | 3300042643 | Bacteria | 2926 |
| 150 | Ga0466704_164921 | 3300042643 | Bacteria | 2986 |
| 151 | Ga0466704_382567 | 3300042643 | Unclassified | 6100 |
| 152 | Ga0466709_202527 | 3300042648 | Bacteria | 5767 |
| 153 | Ga0466708_052390 | 3300042652 | Bacteria | 8755 |
| 154 | Ga0466708_108905 | 3300042652 | Bacteria | 2004 |
| 155 | Ga0466727_174918 | 3300042655 | Bacteria | 2103 |
| 156 | Ga0466727_324910 | 3300042655 | Bacteria | 4975 |
| 157 | Ga0160445_101037 | 3300012847 | Bacteria | 9104 |
| 158 | Ga0160445_104588 | 3300012847 | Bacteria | 2502 |
| 159 | Ga0456237_0012857 | 3300041968 | Bacteria | 1206 |
| 160 | Ga0466690_251560 | 3300042590 | Bacteria | 4706 |
| 161 | Ga0466692_019962 | 3300042591 | Bacteria | 3935 |
| 162 | Ga0466692_183998 | 3300042591 | Unclassified | 1256 |
| 163 | Ga0466696_419660 | 3300042596 | Bacteria | 29493 |
| 164 | Ga0466711_159414 | 3300042615 | Bacteria | 4371 |
| 165 | Ga0466715_325083 | 3300042616 | Bacteria | 37633 |
| 166 | Ga0466726_080484 | 3300042619 | Bacteria | 5554 |
| 167 | Ga0466726_279147 | 3300042619 | Bacteria | 1976 |
| 168 | Ga0466726_312290 | 3300042619 | Bacteria | 3937 |
| 169 | Ga0466728_258978 | 3300042620 | Bacteria | 3796 |
| 170 | Ga0466728_303477 | 3300042620 | Bacteria | 3839 |
| 171 | Ga0466713_151904 | 3300042602 | Unclassified | 26033 |
| 172 | Ga0466716_089706 | 3300042605 | Bacteria | 1629 |
| 173 | Ga0466716_369867 | 3300042605 | Bacteria | 3845 |
| 174 | JGI24703J35330_11748673 | 3300002501 | Bacteria | 24482 |
| 175 | Ga0105005_1279653 | 3300007505 | Bacteria | 2168 |
| 176 | Ga0466697_246277 | 3300042611 | Bacteria | 1655 |
| 177 | Ga0466705_096597 | 3300042612 | Bacteria | 12955 |
| 178 | Ga0466705_147848 | 3300042612 | Bacteria | 4645 |
| 179 | Ga0123355_10125928 | 3300009826 | Bacteria | 3959 |
| 180 | Ga0123355_10240820 | 3300009826 | Bacteria | 2563 |
| 181 | Ga0123356_10089641 | 3300010049 | Bacteria | 2926 |
| 182 | Ga0160464_100513 | 3300012805 | Bacteria | 27181 |
| 183 | Ga0466703_272011 | 3300042636 | Bacteria | 3462 |
| 184 | Ga0466703_356492 | 3300042636 | Bacteria | 4031 |
| 185 | Ga0466704_268643 | 3300042643 | Bacteria | 1238 |
| 186 | Ga0466724_09008 | 3300042649 | Bacteria | 4592 |
| 187 | Ga0466708_198939 | 3300042652 | Bacteria | 6787 |
| 188 | Ga0466708_414157 | 3300042652 | Bacteria | 2275 |
| 189 | Ga0466725_361898 | 3300042654 | Bacteria | 2232 |
| 190 | Ga0466727_092936 | 3300042655 | Bacteria | 2350 |
| 191 | Ga0160441_100152 | 3300012825 | Bacteria | 74865 |
| 192 | Ga0160467_100339 | 3300012829 | Bacteria | 50070 |
| 193 | Ga0466690_014525 | 3300042590 | Bacteria | 1828 |
| 194 | Ga0466692_156861 | 3300042591 | Bacteria | 3468 |
| 195 | Ga0466691_199599 | 3300042593 | Bacteria | 2082 |
| 196 | Ga0466694_008217 | 3300042594 | Bacteria | 6830 |
| 197 | Ga0466711_034198 | 3300042615 | Bacteria | 41145 |
| 198 | Ga0466715_042112 | 3300042616 | Bacteria | 6467 |
| 199 | Ga0466715_273129 | 3300042616 | Bacteria | 7732 |
| 200 | Ga0466715_358736 | 3300042616 | Bacteria | 77251 |
| 201 | Ga0466715_372884 | 3300042616 | Bacteria | 4030 |
| 202 | Ga0466723_253375 | 3300042618 | Unclassified | 2114 |
| 203 | Ga0466726_155468 | 3300042619 | Bacteria | 1806 |
| 204 | Ga0466726_174769 | 3300042619 | Unclassified | 2658 |
| 205 | Ga0466726_192264 | 3300042619 | Bacteria | 5052 |
| 206 | Ga0466707_068989 | 3300042601 | Bacteria | 1413 |
| 207 | Ga0466719_100209 | 3300042606 | Bacteria | 1673 |
| 208 | Ga0466719_407665 | 3300042606 | Bacteria | 5817 |
| 209 | Ga0466722_068725 | 3300042609 | Bacteria | 4563 |
| 210 | Ga0466698_062398 | 3300042610 | Bacteria | 4106 |
| 211 | Ga0466705_043483 | 3300042612 | Bacteria | 1464 |
| 212 | Ga0123356_10038243 | 3300010049 | Bacteria | 4472 |
| 213 | Ga0123356_10262656 | 3300010049 | Bacteria | 1811 |
| 214 | Ga0123353_10505843 | 3300010167 | Bacteria | 1758 |
| 215 | Ga0123353_10512407 | 3300010167 | Bacteria | 1744 |
| 216 | Ga0123353_10668546 | 3300010167 | Bacteria | 1466 |
| 217 | Ga0123354_10115656 | 3300010882 | Bacteria | 3504 |
| 218 | Ga0466703_073743 | 3300042636 | Unclassified | 4101 |
| 219 | Ga0466703_219129 | 3300042636 | Bacteria | 3521 |
| 220 | Ga0466703_373045 | 3300042636 | Bacteria | 1522 |
| 221 | Ga0466704_343940 | 3300042643 | Bacteria | 2689 |
| 222 | Ga0466708_116247 | 3300042652 | Bacteria | 3482 |
| 223 | Ga0466727_105452 | 3300042655 | Bacteria | 2740 |
| 224 | Ga0466727_160903 | 3300042655 | Bacteria | 2637 |
| 225 | Ga0160467_100217 | 3300012829 | Bacteria | 73961 |
| 226 | Ga0160455_100542 | 3300012837 | Bacteria | 17620 |
| 227 | Ga0160445_101744 | 3300012847 | Bacteria | 5703 |
| 228 | Ga0466692_048678 | 3300042591 | Bacteria | 3066 |
| 229 | Ga0466691_001903 | 3300042593 | Bacteria | 16115 |
| 230 | Ga0466691_013689 | 3300042593 | Unclassified | 6282 |
| 231 | Ga0466691_117965 | 3300042593 | Bacteria | 8099 |
| 232 | Ga0466696_445825 | 3300042596 | Bacteria | 3091 |
| 233 | Ga0466705_404921 | 3300042612 | Bacteria | 12677 |
| 234 | Ga0466711_230838 | 3300042615 | Bacteria | 3662 |
| 235 | Ga0466715_021745 | 3300042616 | Bacteria | 6160 |
| 236 | Ga0466715_126879 | 3300042616 | Bacteria | 8055 |
| 237 | Ga0466728_008957 | 3300042620 | Bacteria | 1731 |
| 238 | Ga0466701_061400 | 3300042598 | Bacteria | 2213 |
| 239 | Ga0466716_248957 | 3300042605 | Bacteria | 3291 |
| 240 | Ga0466719_032312 | 3300042606 | Bacteria | 3534 |
| 241 | Ga0466722_218680 | 3300042609 | Bacteria | 4367 |
| 242 | Ga0466722_224799 | 3300042609 | Bacteria | 5370 |
| 243 | Ga0072941_1231791 | 3300005201 | Bacteria | 2838 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 132 | 340 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.