Protein Family IF02187

Metagenome Isolate
259 Members
92 Samples
211 Scaffolds
186.31 Avg Length

🧬 Representative Sequence

ID
3300009784|Ga0123357_10017124|Ga0123357_100171249
Length
201 aa
Sequence
MPAQRNERSKLMAEVYMAGDLRNGTTFEMDNSVYKVVEFQHVKPGKGSAFVRTKLKNVINGSVLEKTFNPSEKLQGAEIEKKDMQYLYNDGDLYYFMDNATYDQTPLNKTDLGDTLKYLKENMNVKILSFKGHVFAIEPPIFVELKVTYTEPGFTGNTAGAGQTKPAETETGYSINVPLFVNTGDVIRIDTRTGDYMERL*

πŸ“Š Sample Types

Isolate 18.5%
Metagenome 81.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 52.7%
Termitidae 25.3%
Kalotermitidae 12.1%
Rhinotermitidae 4.4%
Passalidae 2.2%
Blattidae 2.2%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 1
Bacteria 230
Eukaryota 0
Viruses 0
Unclassified 28

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
2 2820613375 Unclassified Firmicutes Emb289P1bin134 Isolate Unclassified
3 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
4 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
7 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
8 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
9 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
10 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
11 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
14 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
15 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
16 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
17 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
18 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
19 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
20 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
21 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
22 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
23 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
24 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
25 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
26 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
27 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
32 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
33 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
34 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
35 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
36 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
37 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
38 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
39 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
40 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
41 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
42 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
43 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
44 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
45 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
46 2820634724 Unclassified Firmicutes Emb289P1bin116 Isolate Unclassified
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3004667792 Bacteroides sp. 519 Isolate Blattidae
51 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
52 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
53 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
54 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
55 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
56 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
57 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
58 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
59 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
60 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
61 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
62 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
63 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
64 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
65 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
66 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
67 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
68 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
69 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
70 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
71 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
72 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
73 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
74 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
75 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
76 2820646798 Unclassified Firmicutes Cu122P5bin36 Isolate Unclassified
77 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
78 3004677695 Bacteroides sp. 214 Isolate Blattidae
79 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
80 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
81 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
82 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
83 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
84 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
85 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
86 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
87 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
88 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
89 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
90 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
91 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
92 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_091831 3300042659 Bacteria 2422
2 Ga0415639_146921 3300038395 Bacteria 2044
3 Ga0415639_213835 3300038395 Bacteria 1493
4 Ga0466692_179896 3300042591 Unclassified 1921
5 Ga0466693_238781 3300042592 Bacteria 2917
6 Ga0466715_198841 3300042616 Bacteria 1913
7 2227544080 2225789004 Bacteria 15395
8 IMNBL1DRAFT_c0045441 3300000062 Unclassified 1434
9 JGI24695J34938_10000215 3300002450 Bacteria 55239
10 Ga0123355_10000294 3300009826 Bacteria 64075
11 Ga0123355_10001011 3300009826 Bacteria 38991
12 Ga0123355_10003168 3300009826 Bacteria 23487
13 Ga0123355_10047641 3300009826 Bacteria 6970
14 Ga0123355_10056807 3300009826 Bacteria 6334
15 Ga0123355_10064223 3300009826 Bacteria 5918
16 Ga0123355_10116791 3300009826 Bacteria 4150
17 Ga0123355_10122324 3300009826 Bacteria 4033
18 Ga0123355_10318839 3300009826 Bacteria 2097
19 Ga0123355_10500998 3300009826 Bacteria 1498
20 Ga0123355_10575871 3300009826 Bacteria 1348
21 Ga0123355_10647828 3300009826 Unclassified 1234
22 Ga0466706_169291 3300042599 Unclassified 2038
23 Ga0466714_008433 3300042603 Bacteria 4174
24 Ga0466714_040802 3300042603 Bacteria 6541
25 Ga0466714_110057 3300042603 Unclassified 1025
26 Ga0466722_223190 3300042609 Unclassified 1042
27 Ga0466698_504608 3300042610 Bacteria 1614
28 Ga0466702_235815 3300042635 Bacteria 1650
29 Ga0415639_001108 3300038395 Bacteria 18696
30 Ga0415639_003262 3300038395 Bacteria 30933
31 Ga0415639_087348 3300038395 Bacteria 4387
32 Ga0456237_0000001 3300041968 Bacteria 140796
33 Ga0466692_037848 3300042591 Bacteria 6141
34 Ga0466693_175967 3300042592 Bacteria 1681
35 JGI24695J34938_10000163 3300002450 Bacteria 61986
36 JGI24703J35330_11746847 3300002501 Unclassified 5726
37 Ga0068305_10015692 3300005083 Bacteria 23359
38 Ga0123357_10552027 3300009784 Bacteria 918
39 Ga0123355_10002349 3300009826 Bacteria 26749
40 Ga0123355_10016911 3300009826 Bacteria 11507
41 Ga0123355_10041526 3300009826 Bacteria 7488
42 Ga0123355_10128632 3300009826 Archaea 3907
43 Ga0123355_10402028 3300009826 Bacteria 1765
44 Ga0123355_10431423 3300009826 Bacteria 1676
45 Ga0123355_10482345 3300009826 Bacteria 1542
46 Ga0123355_10702389 3300009826 Bacteria 1161
47 Ga0123355_10965496 3300009826 Unclassified 912
48 Ga0123353_10282134 3300010167 Bacteria 2550
49 Ga0466706_053852 3300042599 Bacteria 10109
50 Ga0466706_117449 3300042599 Bacteria 20679
51 Ga0466714_035160 3300042603 Unclassified 2526
52 Ga0466698_281585 3300042610 Bacteria 1770
53 Ga0466733_120279 3300042659 Bacteria 4475
54 Ga0415639_036427 3300038395 Bacteria 6982
55 Ga0466693_081606 3300042592 Bacteria 1570
56 Ga0466691_032381 3300042593 Unclassified 1365
57 JGI24703J35330_11748808 3300002501 Bacteria 39113
58 JGI24705J35276_12238662 3300002504 Bacteria 33887
59 JGI24700J35501_10927126 3300002508 Bacteria 6635
60 Ga0123355_10000317 3300009826 Bacteria 62046
61 Ga0123355_10005381 3300009826 Bacteria 18722
62 Ga0123355_10025852 3300009826 Unclassified 9459
63 Ga0123355_10090445 3300009826 Bacteria 4856
64 Ga0123355_10510451 3300009826 Bacteria 1477
65 Ga0123356_11379026 3300010049 Bacteria 866
66 Ga0123353_10000137 3300010167 Bacteria 88515
67 Ga0123353_10032641 3300010167 Bacteria 8090
68 Ga0466706_064728 3300042599 Bacteria 82048
69 Ga0466714_145700 3300042603 Unclassified 3441
70 Ga0466716_491766 3300042605 Bacteria 3589
71 Ga0466719_035934 3300042606 Bacteria 14785
72 Ga0466729_205120 3300042621 Unclassified 6079
73 Ga0466703_093846 3300042636 Bacteria 5329
74 Ga0466697_270305 3300042611 Unclassified 2282
75 Ga0415639_036967 3300038395 Bacteria 6656
76 Ga0415639_048414 3300038395 Bacteria 3553
77 Ga0466696_194803 3300042596 Bacteria 2402
78 Ga0466715_042981 3300042616 Unclassified 12736
79 JGI24695J34938_10000432 3300002450 Bacteria 40378
80 JGI24695J34938_10051737 3300002450 Bacteria 1795
81 JGI24703J35330_11748017 3300002501 Bacteria 9922
82 Ga0123355_10000528 3300009826 Bacteria 51183
83 Ga0123355_10007132 3300009826 Bacteria 16679
84 Ga0123355_10029055 3300009826 Bacteria 8944
85 Ga0123355_10080413 3300009826 Bacteria 5204
86 Ga0123355_10172121 3300009826 Bacteria 3233
87 Ga0123355_10208084 3300009826 Bacteria 2842
88 Ga0123355_10236566 3300009826 Bacteria 2597
89 Ga0123355_10246862 3300009826 Bacteria 2520
90 Ga0123355_10401181 3300009826 Bacteria 1768
91 Ga0123355_10405549 3300009826 Bacteria 1754
92 Ga0123355_10421653 3300009826 Bacteria 1705
93 Ga0123355_10930188 3300009826 Bacteria 938
94 Ga0123355_11000103 3300009826 Bacteria 888
95 Ga0123355_11474796 3300009826 Bacteria 666
96 Ga0123353_10100065 3300010167 Unclassified 4672
97 Ga0466706_052437 3300042599 Bacteria 11745
98 Ga0466707_190925 3300042601 Bacteria 1247
99 Ga0466717_216200 3300042604 Bacteria 1178
100 Ga0466725_315555 3300042654 Bacteria 8984
101 JGI24695J34938_10168645 3300002450 Bacteria 902
102 JGI24695J34938_10387877 3300002450 Bacteria 620
103 JGI24703J35330_11748397 3300002501 Bacteria 15326
104 JGI24705J35276_12225865 3300002504 Unclassified 2778
105 Ga0123355_10004606 3300009826 Bacteria 20050
106 Ga0123355_10029995 3300009826 Bacteria 8812
107 Ga0123355_10051257 3300009826 Bacteria 6699
108 Ga0123355_10151850 3300009826 Bacteria 3516
109 Ga0123355_10301763 3300009826 Bacteria 2182
110 Ga0123355_10594721 3300009826 Bacteria 1316
111 Ga0123353_10472179 3300010167 Bacteria 1839
112 Ga0466706_065377 3300042599 Unclassified 1756
113 Ga0466706_136031 3300042599 Bacteria 7859
114 Ga0466700_031175 3300042600 Bacteria 15890
115 Ga0466700_193594 3300042600 Bacteria 1108
116 Ga0466713_057786 3300042602 Bacteria 32272
117 Ga0466703_274239 3300042636 Unclassified 1202
118 Ga0466725_211932 3300042654 Bacteria 1985
119 Ga0415639_197214 3300038395 Bacteria 1942
120 Ga0466690_192924 3300042590 Bacteria 13990
121 Ga0466693_163884 3300042592 Bacteria 1111
122 Ga0466693_230170 3300042592 Bacteria 1180
123 Ga0466699_238764 3300042597 Bacteria 2717
124 Ga0466705_425307 3300042612 Bacteria 10180
125 JGI24703J35330_11748466 3300002501 Bacteria 17016
126 Ga0123357_10279183 3300009784 Bacteria 1729
127 Ga0123355_10000806 3300009826 Bacteria 42849
128 Ga0123355_10004478 3300009826 Bacteria 20325
129 Ga0123355_10079848 3300009826 Bacteria 5224
130 Ga0123355_10133520 3300009826 Bacteria 3818
131 Ga0123355_10498656 3300009826 Bacteria 1503
132 Ga0123355_10648202 3300009826 Bacteria 1233
133 Ga0123355_10792478 3300009826 Bacteria 1059
134 Ga0123355_10799235 3300009826 Unclassified 1052
135 Ga0123355_10814957 3300009826 Bacteria 1037
136 Ga0123356_10009885 3300010049 Bacteria 9395
137 Ga0123353_10189949 3300010167 Bacteria 3243
138 Ga0466706_092309 3300042599 Unclassified 1196
139 Ga0466714_053984 3300042603 Bacteria 1217
140 Ga0466714_145566 3300042603 Bacteria 4045
141 Ga0466721_104135 3300042608 Bacteria 2251
142 Ga0466703_036481 3300042636 Unclassified 10404
143 Ga0466703_069228 3300042636 Bacteria 4237
144 Ga0466705_052466 3300042612 Bacteria 3735
145 Ga0415639_049092 3300038395 Bacteria 7751
146 Ga0415639_209673 3300038395 Bacteria 1680
147 Ga0466728_024886 3300042620 Bacteria 15208
148 JGI24702J35022_10007286 3300002462 Unclassified 6350
149 JGI24696J40584_12959663 3300002834 Bacteria 5437
150 Ga0123357_10017124 3300009784 Bacteria 9578
151 Ga0123357_10084730 3300009784 Bacteria 4153
152 Ga0123355_10000029 3300009826 Bacteria 143843
153 Ga0123355_10000234 3300009826 Bacteria 70892
154 Ga0123355_10001453 3300009826 Bacteria 32948
155 Ga0123355_10020804 3300009826 Bacteria 10487
156 Ga0123355_10028454 3300009826 Bacteria 9037
157 Ga0123355_10037242 3300009826 Bacteria 7909
158 Ga0123355_10052165 3300009826 Bacteria 6637
159 Ga0123355_10057003 3300009826 Bacteria 6324
160 Ga0123355_10079759 3300009826 Bacteria 5227
161 Ga0123355_10175861 3300009826 Bacteria 3188
162 Ga0123355_10221543 3300009826 Bacteria 2719
163 Ga0123355_10356770 3300009826 Bacteria 1930
164 Ga0123355_10399734 3300009826 Bacteria 1773
165 Ga0123355_10443232 3300009826 Bacteria 1642
166 Ga0123355_10445043 3300009826 Bacteria 1637
167 Ga0123355_10638694 3300009826 Bacteria 1247
168 Ga0123355_10726425 3300009826 Bacteria 1131
169 Ga0123356_10000536 3300010049 Bacteria 42210
170 Ga0123356_11792053 3300010049 Bacteria 763
171 Ga0123353_11515621 3300010167 Bacteria 853
172 Ga0123353_11702428 3300010167 Bacteria 790
173 Ga0466706_287724 3300042599 Bacteria 1305
174 Ga0466700_442063 3300042600 Bacteria 1576
175 Ga0466721_251514 3300042608 Bacteria 1432
176 Ga0466722_096452 3300042609 Bacteria 12880
177 Ga0466702_004802 3300042635 Bacteria 1375
178 Ga0466702_191958 3300042635 Bacteria 1197
179 Ga0466709_247116 3300042648 Bacteria 53881
180 Ga0415639_108878 3300038395 Bacteria 2236
181 Ga0466692_146124 3300042591 Unclassified 1320
182 Ga0466693_152123 3300042592 Bacteria 7367
183 JGI24703J35330_11732954 3300002501 Bacteria 2820
184 JGI24705J35276_12238254 3300002504 Bacteria 17950
185 Ga0072941_1539619 3300005201 Bacteria 914
186 Ga0123355_10000283 3300009826 Bacteria 64994
187 Ga0123355_10001263 3300009826 Bacteria 35338
188 Ga0123355_10001896 3300009826 Bacteria 29385
189 Ga0123355_10003283 3300009826 Bacteria 23135
190 Ga0123355_10003557 3300009826 Bacteria 22399
191 Ga0123355_10006778 3300009826 Bacteria 17050
192 Ga0123355_10023293 3300009826 Bacteria 9944
193 Ga0123355_10150202 3300009826 Bacteria 3541
194 Ga0123355_10174812 3300009826 Unclassified 3201
195 Ga0123355_10191301 3300009826 Bacteria 3013
196 Ga0123355_10192697 3300009826 Bacteria 2998
197 Ga0123355_10195049 3300009826 Bacteria 2972
198 Ga0123355_10270157 3300009826 Unclassified 2364
199 Ga0123355_10368906 3300009826 Bacteria 1883
200 Ga0123355_10419996 3300009826 Bacteria 1710
201 Ga0123355_10432133 3300009826 Unclassified 1674
202 Ga0123355_10573427 3300009826 Bacteria 1353
203 Ga0123353_10407255 3300010167 Bacteria 2021
204 Ga0466706_094142 3300042599 Bacteria 6772
205 Ga0466706_109078 3300042599 Bacteria 1306
206 Ga0466714_014502 3300042603 Bacteria 12834
207 Ga0466714_029328 3300042603 Bacteria 1732
208 Ga0466719_005836 3300042606 Bacteria 1071
209 Ga0466702_090049 3300042635 Bacteria 6688
210 Ga0466704_494500 3300042643 Unclassified 11799
211 Ga0466725_033318 3300042654 Bacteria 3781

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF09285 Elong-fact-P_C Elongation factor P, C-terminal 143 199 0.99
PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain 18 74 0.98
PF01132 EFP Elongation factor P (EF-P) OB domain 82 133 0.97

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.