Protein Family IF02187
Metagenome
Isolate
259
Members
92
Samples
211
Scaffolds
186.31
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10017124|Ga0123357_100171249
- Length
- 201 aa
- Sequence
- MPAQRNERSKLMAEVYMAGDLRNGTTFEMDNSVYKVVEFQHVKPGKGSAFVRTKLKNVINGSVLEKTFNPSEKLQGAEIEKKDMQYLYNDGDLYYFMDNATYDQTPLNKTDLGDTLKYLKENMNVKILSFKGHVFAIEPPIFVELKVTYTEPGFTGNTAGAGQTKPAETETGYSINVPLFVNTGDVIRIDTRTGDYMERL*
Sample Types
Isolate
18.5%
Metagenome
81.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
52.7%
Termitidae
25.3%
Kalotermitidae
12.1%
Rhinotermitidae
4.4%
Passalidae
2.2%
Blattidae
2.2%
Hodotermitidae
1.1%
Taxonomy
Archaea
1
Bacteria
230
Eukaryota
0
Viruses
0
Unclassified
28
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 2 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 3 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 4 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 14 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 15 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 21 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 22 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 23 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 24 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 25 | 2820581541 | Unclassified Firmicutes Emb289P3bin127 | Isolate | Unclassified |
| 26 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 27 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 31 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 32 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 33 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 34 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 35 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 36 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 37 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 38 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 39 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 40 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 41 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 42 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 43 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 44 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 45 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 46 | 2820634724 | Unclassified Firmicutes Emb289P1bin116 | Isolate | Unclassified |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 51 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 52 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 53 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 54 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 55 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 56 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 57 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 58 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 59 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 60 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 61 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 62 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 63 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 64 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 65 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 66 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 67 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 68 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 69 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 70 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 71 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 72 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 73 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 74 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 75 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 76 | 2820646798 | Unclassified Firmicutes Cu122P5bin36 | Isolate | Unclassified |
| 77 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 78 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 79 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 80 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 81 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 82 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 83 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 84 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 85 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 86 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 87 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 88 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 89 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 90 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 91 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 92 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_091831 | 3300042659 | Bacteria | 2422 |
| 2 | Ga0415639_146921 | 3300038395 | Bacteria | 2044 |
| 3 | Ga0415639_213835 | 3300038395 | Bacteria | 1493 |
| 4 | Ga0466692_179896 | 3300042591 | Unclassified | 1921 |
| 5 | Ga0466693_238781 | 3300042592 | Bacteria | 2917 |
| 6 | Ga0466715_198841 | 3300042616 | Bacteria | 1913 |
| 7 | 2227544080 | 2225789004 | Bacteria | 15395 |
| 8 | IMNBL1DRAFT_c0045441 | 3300000062 | Unclassified | 1434 |
| 9 | JGI24695J34938_10000215 | 3300002450 | Bacteria | 55239 |
| 10 | Ga0123355_10000294 | 3300009826 | Bacteria | 64075 |
| 11 | Ga0123355_10001011 | 3300009826 | Bacteria | 38991 |
| 12 | Ga0123355_10003168 | 3300009826 | Bacteria | 23487 |
| 13 | Ga0123355_10047641 | 3300009826 | Bacteria | 6970 |
| 14 | Ga0123355_10056807 | 3300009826 | Bacteria | 6334 |
| 15 | Ga0123355_10064223 | 3300009826 | Bacteria | 5918 |
| 16 | Ga0123355_10116791 | 3300009826 | Bacteria | 4150 |
| 17 | Ga0123355_10122324 | 3300009826 | Bacteria | 4033 |
| 18 | Ga0123355_10318839 | 3300009826 | Bacteria | 2097 |
| 19 | Ga0123355_10500998 | 3300009826 | Bacteria | 1498 |
| 20 | Ga0123355_10575871 | 3300009826 | Bacteria | 1348 |
| 21 | Ga0123355_10647828 | 3300009826 | Unclassified | 1234 |
| 22 | Ga0466706_169291 | 3300042599 | Unclassified | 2038 |
| 23 | Ga0466714_008433 | 3300042603 | Bacteria | 4174 |
| 24 | Ga0466714_040802 | 3300042603 | Bacteria | 6541 |
| 25 | Ga0466714_110057 | 3300042603 | Unclassified | 1025 |
| 26 | Ga0466722_223190 | 3300042609 | Unclassified | 1042 |
| 27 | Ga0466698_504608 | 3300042610 | Bacteria | 1614 |
| 28 | Ga0466702_235815 | 3300042635 | Bacteria | 1650 |
| 29 | Ga0415639_001108 | 3300038395 | Bacteria | 18696 |
| 30 | Ga0415639_003262 | 3300038395 | Bacteria | 30933 |
| 31 | Ga0415639_087348 | 3300038395 | Bacteria | 4387 |
| 32 | Ga0456237_0000001 | 3300041968 | Bacteria | 140796 |
| 33 | Ga0466692_037848 | 3300042591 | Bacteria | 6141 |
| 34 | Ga0466693_175967 | 3300042592 | Bacteria | 1681 |
| 35 | JGI24695J34938_10000163 | 3300002450 | Bacteria | 61986 |
| 36 | JGI24703J35330_11746847 | 3300002501 | Unclassified | 5726 |
| 37 | Ga0068305_10015692 | 3300005083 | Bacteria | 23359 |
| 38 | Ga0123357_10552027 | 3300009784 | Bacteria | 918 |
| 39 | Ga0123355_10002349 | 3300009826 | Bacteria | 26749 |
| 40 | Ga0123355_10016911 | 3300009826 | Bacteria | 11507 |
| 41 | Ga0123355_10041526 | 3300009826 | Bacteria | 7488 |
| 42 | Ga0123355_10128632 | 3300009826 | Archaea | 3907 |
| 43 | Ga0123355_10402028 | 3300009826 | Bacteria | 1765 |
| 44 | Ga0123355_10431423 | 3300009826 | Bacteria | 1676 |
| 45 | Ga0123355_10482345 | 3300009826 | Bacteria | 1542 |
| 46 | Ga0123355_10702389 | 3300009826 | Bacteria | 1161 |
| 47 | Ga0123355_10965496 | 3300009826 | Unclassified | 912 |
| 48 | Ga0123353_10282134 | 3300010167 | Bacteria | 2550 |
| 49 | Ga0466706_053852 | 3300042599 | Bacteria | 10109 |
| 50 | Ga0466706_117449 | 3300042599 | Bacteria | 20679 |
| 51 | Ga0466714_035160 | 3300042603 | Unclassified | 2526 |
| 52 | Ga0466698_281585 | 3300042610 | Bacteria | 1770 |
| 53 | Ga0466733_120279 | 3300042659 | Bacteria | 4475 |
| 54 | Ga0415639_036427 | 3300038395 | Bacteria | 6982 |
| 55 | Ga0466693_081606 | 3300042592 | Bacteria | 1570 |
| 56 | Ga0466691_032381 | 3300042593 | Unclassified | 1365 |
| 57 | JGI24703J35330_11748808 | 3300002501 | Bacteria | 39113 |
| 58 | JGI24705J35276_12238662 | 3300002504 | Bacteria | 33887 |
| 59 | JGI24700J35501_10927126 | 3300002508 | Bacteria | 6635 |
| 60 | Ga0123355_10000317 | 3300009826 | Bacteria | 62046 |
| 61 | Ga0123355_10005381 | 3300009826 | Bacteria | 18722 |
| 62 | Ga0123355_10025852 | 3300009826 | Unclassified | 9459 |
| 63 | Ga0123355_10090445 | 3300009826 | Bacteria | 4856 |
| 64 | Ga0123355_10510451 | 3300009826 | Bacteria | 1477 |
| 65 | Ga0123356_11379026 | 3300010049 | Bacteria | 866 |
| 66 | Ga0123353_10000137 | 3300010167 | Bacteria | 88515 |
| 67 | Ga0123353_10032641 | 3300010167 | Bacteria | 8090 |
| 68 | Ga0466706_064728 | 3300042599 | Bacteria | 82048 |
| 69 | Ga0466714_145700 | 3300042603 | Unclassified | 3441 |
| 70 | Ga0466716_491766 | 3300042605 | Bacteria | 3589 |
| 71 | Ga0466719_035934 | 3300042606 | Bacteria | 14785 |
| 72 | Ga0466729_205120 | 3300042621 | Unclassified | 6079 |
| 73 | Ga0466703_093846 | 3300042636 | Bacteria | 5329 |
| 74 | Ga0466697_270305 | 3300042611 | Unclassified | 2282 |
| 75 | Ga0415639_036967 | 3300038395 | Bacteria | 6656 |
| 76 | Ga0415639_048414 | 3300038395 | Bacteria | 3553 |
| 77 | Ga0466696_194803 | 3300042596 | Bacteria | 2402 |
| 78 | Ga0466715_042981 | 3300042616 | Unclassified | 12736 |
| 79 | JGI24695J34938_10000432 | 3300002450 | Bacteria | 40378 |
| 80 | JGI24695J34938_10051737 | 3300002450 | Bacteria | 1795 |
| 81 | JGI24703J35330_11748017 | 3300002501 | Bacteria | 9922 |
| 82 | Ga0123355_10000528 | 3300009826 | Bacteria | 51183 |
| 83 | Ga0123355_10007132 | 3300009826 | Bacteria | 16679 |
| 84 | Ga0123355_10029055 | 3300009826 | Bacteria | 8944 |
| 85 | Ga0123355_10080413 | 3300009826 | Bacteria | 5204 |
| 86 | Ga0123355_10172121 | 3300009826 | Bacteria | 3233 |
| 87 | Ga0123355_10208084 | 3300009826 | Bacteria | 2842 |
| 88 | Ga0123355_10236566 | 3300009826 | Bacteria | 2597 |
| 89 | Ga0123355_10246862 | 3300009826 | Bacteria | 2520 |
| 90 | Ga0123355_10401181 | 3300009826 | Bacteria | 1768 |
| 91 | Ga0123355_10405549 | 3300009826 | Bacteria | 1754 |
| 92 | Ga0123355_10421653 | 3300009826 | Bacteria | 1705 |
| 93 | Ga0123355_10930188 | 3300009826 | Bacteria | 938 |
| 94 | Ga0123355_11000103 | 3300009826 | Bacteria | 888 |
| 95 | Ga0123355_11474796 | 3300009826 | Bacteria | 666 |
| 96 | Ga0123353_10100065 | 3300010167 | Unclassified | 4672 |
| 97 | Ga0466706_052437 | 3300042599 | Bacteria | 11745 |
| 98 | Ga0466707_190925 | 3300042601 | Bacteria | 1247 |
| 99 | Ga0466717_216200 | 3300042604 | Bacteria | 1178 |
| 100 | Ga0466725_315555 | 3300042654 | Bacteria | 8984 |
| 101 | JGI24695J34938_10168645 | 3300002450 | Bacteria | 902 |
| 102 | JGI24695J34938_10387877 | 3300002450 | Bacteria | 620 |
| 103 | JGI24703J35330_11748397 | 3300002501 | Bacteria | 15326 |
| 104 | JGI24705J35276_12225865 | 3300002504 | Unclassified | 2778 |
| 105 | Ga0123355_10004606 | 3300009826 | Bacteria | 20050 |
| 106 | Ga0123355_10029995 | 3300009826 | Bacteria | 8812 |
| 107 | Ga0123355_10051257 | 3300009826 | Bacteria | 6699 |
| 108 | Ga0123355_10151850 | 3300009826 | Bacteria | 3516 |
| 109 | Ga0123355_10301763 | 3300009826 | Bacteria | 2182 |
| 110 | Ga0123355_10594721 | 3300009826 | Bacteria | 1316 |
| 111 | Ga0123353_10472179 | 3300010167 | Bacteria | 1839 |
| 112 | Ga0466706_065377 | 3300042599 | Unclassified | 1756 |
| 113 | Ga0466706_136031 | 3300042599 | Bacteria | 7859 |
| 114 | Ga0466700_031175 | 3300042600 | Bacteria | 15890 |
| 115 | Ga0466700_193594 | 3300042600 | Bacteria | 1108 |
| 116 | Ga0466713_057786 | 3300042602 | Bacteria | 32272 |
| 117 | Ga0466703_274239 | 3300042636 | Unclassified | 1202 |
| 118 | Ga0466725_211932 | 3300042654 | Bacteria | 1985 |
| 119 | Ga0415639_197214 | 3300038395 | Bacteria | 1942 |
| 120 | Ga0466690_192924 | 3300042590 | Bacteria | 13990 |
| 121 | Ga0466693_163884 | 3300042592 | Bacteria | 1111 |
| 122 | Ga0466693_230170 | 3300042592 | Bacteria | 1180 |
| 123 | Ga0466699_238764 | 3300042597 | Bacteria | 2717 |
| 124 | Ga0466705_425307 | 3300042612 | Bacteria | 10180 |
| 125 | JGI24703J35330_11748466 | 3300002501 | Bacteria | 17016 |
| 126 | Ga0123357_10279183 | 3300009784 | Bacteria | 1729 |
| 127 | Ga0123355_10000806 | 3300009826 | Bacteria | 42849 |
| 128 | Ga0123355_10004478 | 3300009826 | Bacteria | 20325 |
| 129 | Ga0123355_10079848 | 3300009826 | Bacteria | 5224 |
| 130 | Ga0123355_10133520 | 3300009826 | Bacteria | 3818 |
| 131 | Ga0123355_10498656 | 3300009826 | Bacteria | 1503 |
| 132 | Ga0123355_10648202 | 3300009826 | Bacteria | 1233 |
| 133 | Ga0123355_10792478 | 3300009826 | Bacteria | 1059 |
| 134 | Ga0123355_10799235 | 3300009826 | Unclassified | 1052 |
| 135 | Ga0123355_10814957 | 3300009826 | Bacteria | 1037 |
| 136 | Ga0123356_10009885 | 3300010049 | Bacteria | 9395 |
| 137 | Ga0123353_10189949 | 3300010167 | Bacteria | 3243 |
| 138 | Ga0466706_092309 | 3300042599 | Unclassified | 1196 |
| 139 | Ga0466714_053984 | 3300042603 | Bacteria | 1217 |
| 140 | Ga0466714_145566 | 3300042603 | Bacteria | 4045 |
| 141 | Ga0466721_104135 | 3300042608 | Bacteria | 2251 |
| 142 | Ga0466703_036481 | 3300042636 | Unclassified | 10404 |
| 143 | Ga0466703_069228 | 3300042636 | Bacteria | 4237 |
| 144 | Ga0466705_052466 | 3300042612 | Bacteria | 3735 |
| 145 | Ga0415639_049092 | 3300038395 | Bacteria | 7751 |
| 146 | Ga0415639_209673 | 3300038395 | Bacteria | 1680 |
| 147 | Ga0466728_024886 | 3300042620 | Bacteria | 15208 |
| 148 | JGI24702J35022_10007286 | 3300002462 | Unclassified | 6350 |
| 149 | JGI24696J40584_12959663 | 3300002834 | Bacteria | 5437 |
| 150 | Ga0123357_10017124 | 3300009784 | Bacteria | 9578 |
| 151 | Ga0123357_10084730 | 3300009784 | Bacteria | 4153 |
| 152 | Ga0123355_10000029 | 3300009826 | Bacteria | 143843 |
| 153 | Ga0123355_10000234 | 3300009826 | Bacteria | 70892 |
| 154 | Ga0123355_10001453 | 3300009826 | Bacteria | 32948 |
| 155 | Ga0123355_10020804 | 3300009826 | Bacteria | 10487 |
| 156 | Ga0123355_10028454 | 3300009826 | Bacteria | 9037 |
| 157 | Ga0123355_10037242 | 3300009826 | Bacteria | 7909 |
| 158 | Ga0123355_10052165 | 3300009826 | Bacteria | 6637 |
| 159 | Ga0123355_10057003 | 3300009826 | Bacteria | 6324 |
| 160 | Ga0123355_10079759 | 3300009826 | Bacteria | 5227 |
| 161 | Ga0123355_10175861 | 3300009826 | Bacteria | 3188 |
| 162 | Ga0123355_10221543 | 3300009826 | Bacteria | 2719 |
| 163 | Ga0123355_10356770 | 3300009826 | Bacteria | 1930 |
| 164 | Ga0123355_10399734 | 3300009826 | Bacteria | 1773 |
| 165 | Ga0123355_10443232 | 3300009826 | Bacteria | 1642 |
| 166 | Ga0123355_10445043 | 3300009826 | Bacteria | 1637 |
| 167 | Ga0123355_10638694 | 3300009826 | Bacteria | 1247 |
| 168 | Ga0123355_10726425 | 3300009826 | Bacteria | 1131 |
| 169 | Ga0123356_10000536 | 3300010049 | Bacteria | 42210 |
| 170 | Ga0123356_11792053 | 3300010049 | Bacteria | 763 |
| 171 | Ga0123353_11515621 | 3300010167 | Bacteria | 853 |
| 172 | Ga0123353_11702428 | 3300010167 | Bacteria | 790 |
| 173 | Ga0466706_287724 | 3300042599 | Bacteria | 1305 |
| 174 | Ga0466700_442063 | 3300042600 | Bacteria | 1576 |
| 175 | Ga0466721_251514 | 3300042608 | Bacteria | 1432 |
| 176 | Ga0466722_096452 | 3300042609 | Bacteria | 12880 |
| 177 | Ga0466702_004802 | 3300042635 | Bacteria | 1375 |
| 178 | Ga0466702_191958 | 3300042635 | Bacteria | 1197 |
| 179 | Ga0466709_247116 | 3300042648 | Bacteria | 53881 |
| 180 | Ga0415639_108878 | 3300038395 | Bacteria | 2236 |
| 181 | Ga0466692_146124 | 3300042591 | Unclassified | 1320 |
| 182 | Ga0466693_152123 | 3300042592 | Bacteria | 7367 |
| 183 | JGI24703J35330_11732954 | 3300002501 | Bacteria | 2820 |
| 184 | JGI24705J35276_12238254 | 3300002504 | Bacteria | 17950 |
| 185 | Ga0072941_1539619 | 3300005201 | Bacteria | 914 |
| 186 | Ga0123355_10000283 | 3300009826 | Bacteria | 64994 |
| 187 | Ga0123355_10001263 | 3300009826 | Bacteria | 35338 |
| 188 | Ga0123355_10001896 | 3300009826 | Bacteria | 29385 |
| 189 | Ga0123355_10003283 | 3300009826 | Bacteria | 23135 |
| 190 | Ga0123355_10003557 | 3300009826 | Bacteria | 22399 |
| 191 | Ga0123355_10006778 | 3300009826 | Bacteria | 17050 |
| 192 | Ga0123355_10023293 | 3300009826 | Bacteria | 9944 |
| 193 | Ga0123355_10150202 | 3300009826 | Bacteria | 3541 |
| 194 | Ga0123355_10174812 | 3300009826 | Unclassified | 3201 |
| 195 | Ga0123355_10191301 | 3300009826 | Bacteria | 3013 |
| 196 | Ga0123355_10192697 | 3300009826 | Bacteria | 2998 |
| 197 | Ga0123355_10195049 | 3300009826 | Bacteria | 2972 |
| 198 | Ga0123355_10270157 | 3300009826 | Unclassified | 2364 |
| 199 | Ga0123355_10368906 | 3300009826 | Bacteria | 1883 |
| 200 | Ga0123355_10419996 | 3300009826 | Bacteria | 1710 |
| 201 | Ga0123355_10432133 | 3300009826 | Unclassified | 1674 |
| 202 | Ga0123355_10573427 | 3300009826 | Bacteria | 1353 |
| 203 | Ga0123353_10407255 | 3300010167 | Bacteria | 2021 |
| 204 | Ga0466706_094142 | 3300042599 | Bacteria | 6772 |
| 205 | Ga0466706_109078 | 3300042599 | Bacteria | 1306 |
| 206 | Ga0466714_014502 | 3300042603 | Bacteria | 12834 |
| 207 | Ga0466714_029328 | 3300042603 | Bacteria | 1732 |
| 208 | Ga0466719_005836 | 3300042606 | Bacteria | 1071 |
| 209 | Ga0466702_090049 | 3300042635 | Bacteria | 6688 |
| 210 | Ga0466704_494500 | 3300042643 | Unclassified | 11799 |
| 211 | Ga0466725_033318 | 3300042654 | Bacteria | 3781 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.