Protein Family IF02186
Metagenome
Isolate
264
Members
82
Samples
242
Scaffolds
503.47
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10015481|Ga0123357_100154814
- Length
- 577 aa
- Sequence
- LGKVIPTTIPTTFFRLKTNTRKFSCIRKIAEKAGTRLTKDFLPLEFLPDIIRVGDPPKASADMMAIEPDSQEVNYVALTTNSATIGFEQQIWAAADILRGNMDAAEYKHVVLGLIFLKYISDKFEERYHELEADDDDVEDKDAYAEANVFFVPSSARWSIIAEAAHKEKIGTVIDDAMRAIEKENKRLKDTLPKNYARDELDKRRLGNVVDLFTNIRMTEHGTDKDILGRTYEYCLAKFAEQEGKRAGEFYTPSCVVRTLVEVLQPFKGRVYDPCCGSGGMFVQSTDFVRSHSGNIGNLSIYGQDANPTTRKMALMNLAIRGIEADLGGYNADTFHNDLHPQQKMDFILANPPFNLSDWNDGSLNNDPRWKYGLPPSGNANFAWLQHMIFHLSPNGKIGMVLANGSLSSQSGGEGEIRRKIAEDDLVEGIIAMPTQLFYTTQIPVSLWFISRNKQQKGKTLFIDARKMGTMVNRRLREMTAEDIAKIASTFQAFDKGALEDVKGYCAAVTTEEIAKQDYILTPGRYVGIEEQEDDGEPFEEKMTRLTGELSGMFKRSHELEEEIRKRLGAIGYEIE*
Sample Types
Isolate
8.3%
Metagenome
91.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.5%
Unclassified
20.3%
Kalotermitidae
16.5%
Blattidae
8.9%
Rhinotermitidae
5.1%
Termopsidae
5.1%
Passalidae
2.5%
Hodotermitidae
1.3%
Taxonomy
Archaea
5
Bacteria
247
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 3 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 4 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 5 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 6 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 7 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 8 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 9 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 14 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 15 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 18 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 19 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 24 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 25 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 26 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 27 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 30 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 31 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 32 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 2820854745 | Unclassified Actinobacteria Lab288P3bin234 | Isolate | Unclassified |
| 37 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 38 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 39 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 42 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 43 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 48 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 49 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 50 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 51 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 52 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 53 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 54 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 56 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 57 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 58 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 59 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 60 | 2684622740 | Methanobrevibacter filiformis DSM11501 | Isolate | Unclassified |
| 61 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 62 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 63 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 64 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 65 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 66 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 67 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 68 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 69 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 70 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 71 | 2684622743 | Methanobrevibacter cuticularis DSM11139 | Isolate | Unclassified |
| 72 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 73 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 74 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 75 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 76 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 77 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 78 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 79 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 80 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 81 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 82 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_269339 | 3300042612 | Bacteria | 15313 |
| 2 | Ga0466733_044560 | 3300042659 | Bacteria | 4317 |
| 3 | Ga0466733_047845 | 3300042659 | Bacteria | 3376 |
| 4 | Ga0466712_027439 | 3300042614 | Bacteria | 6073 |
| 5 | Ga0466711_517503 | 3300042615 | Bacteria | 3739 |
| 6 | Ga0466715_026093 | 3300042616 | Bacteria | 7540 |
| 7 | Ga0466715_239488 | 3300042616 | Bacteria | 34655 |
| 8 | Ga0466718_032062 | 3300042617 | Bacteria | 4936 |
| 9 | Ga0466726_297041 | 3300042619 | Bacteria | 6709 |
| 10 | Ga0466726_349157 | 3300042619 | Bacteria | 3149 |
| 11 | Ga0415639_014526 | 3300038395 | Bacteria | 7884 |
| 12 | Ga0466699_029069 | 3300042597 | Bacteria | 2684 |
| 13 | Ga0123355_10014436 | 3300009826 | Bacteria | 12358 |
| 14 | Ga0123355_10081409 | 3300009826 | Bacteria | 5167 |
| 15 | Ga0123356_10000619 | 3300010049 | Bacteria | 39296 |
| 16 | Ga0123356_10018930 | 3300010049 | Bacteria | 6532 |
| 17 | Ga0123353_10189487 | 3300010167 | Bacteria | 3248 |
| 18 | Ga0123353_10195576 | 3300010167 | Bacteria | 3188 |
| 19 | Ga0123353_10197194 | 3300010167 | Bacteria | 3172 |
| 20 | Ga0123354_10054856 | 3300010882 | Bacteria | 5973 |
| 21 | Ga0466714_094322 | 3300042603 | Bacteria | 2250 |
| 22 | Ga0466716_223040 | 3300042605 | Archaea | 9195 |
| 23 | Ga0466716_447979 | 3300042605 | Bacteria | 1762 |
| 24 | Ga0466719_108189 | 3300042606 | Bacteria | 7965 |
| 25 | Ga0466719_267204 | 3300042606 | Bacteria | 1781 |
| 26 | Ga0466720_047860 | 3300042607 | Bacteria | 8837 |
| 27 | Ga0466722_027826 | 3300042609 | Bacteria | 4602 |
| 28 | Ga0466722_138220 | 3300042609 | Bacteria | 14645 |
| 29 | 2230969630 | 2228664004 | Bacteria | 8432 |
| 30 | AustNasuHG_c1007694 | 3300000089 | Bacteria | 3823 |
| 31 | JGI24695J34938_10024800 | 3300002450 | Bacteria | 2876 |
| 32 | Ga0466729_233783 | 3300042621 | Bacteria | 2117 |
| 33 | Ga0466702_264004 | 3300042635 | Bacteria | 1956 |
| 34 | Ga0466708_271535 | 3300042652 | Bacteria | 23806 |
| 35 | Ga0466733_194957 | 3300042659 | Bacteria | 2357 |
| 36 | Ga0466705_502735 | 3300042612 | Bacteria | 2194 |
| 37 | Ga0466711_339321 | 3300042615 | Bacteria | 4919 |
| 38 | Ga0466715_115531 | 3300042616 | Bacteria | 7438 |
| 39 | Ga0466718_064682 | 3300042617 | Bacteria | 16410 |
| 40 | Ga0466718_112161 | 3300042617 | Bacteria | 5318 |
| 41 | Ga0466728_321141 | 3300042620 | Bacteria | 5426 |
| 42 | Ga0466691_097150 | 3300042593 | Bacteria | 2267 |
| 43 | Ga0466694_334680 | 3300042594 | Bacteria | 3972 |
| 44 | Ga0466696_127557 | 3300042596 | Bacteria | 8509 |
| 45 | Ga0466696_388913 | 3300042596 | Bacteria | 2292 |
| 46 | Ga0123355_10000706 | 3300009826 | Bacteria | 45274 |
| 47 | Ga0123356_10016994 | 3300010049 | Bacteria | 6929 |
| 48 | Ga0123353_10000477 | 3300010167 | Bacteria | 49516 |
| 49 | Ga0123353_10010859 | 3300010167 | Bacteria | 12755 |
| 50 | Ga0123353_10174449 | 3300010167 | Bacteria | 3410 |
| 51 | Ga0466706_004357 | 3300042599 | Bacteria | 5121 |
| 52 | Ga0466706_042493 | 3300042599 | Bacteria | 5156 |
| 53 | Ga0466706_048139 | 3300042599 | Bacteria | 2415 |
| 54 | Ga0466706_103844 | 3300042599 | Bacteria | 35455 |
| 55 | Ga0466706_163306 | 3300042599 | Bacteria | 10413 |
| 56 | Ga0466707_078166 | 3300042601 | Archaea | 12451 |
| 57 | Ga0466722_011327 | 3300042609 | Bacteria | 2986 |
| 58 | Ga0466722_257403 | 3300042609 | Bacteria | 4501 |
| 59 | 2227108572 | 2225789004 | Bacteria | 39065 |
| 60 | AustNasuHG_c1000351 | 3300000089 | Bacteria | 15988 |
| 61 | AustNasuHG_c1003343 | 3300000089 | Bacteria | 5789 |
| 62 | JGI24698J34947_10006027 | 3300002449 | Bacteria | 6657 |
| 63 | JGI24695J34938_10014441 | 3300002450 | Bacteria | 4094 |
| 64 | JGI24695J34938_10043196 | 3300002450 | Unclassified | 2012 |
| 65 | JGI24696J40584_12959784 | 3300002834 | Bacteria | 5633 |
| 66 | Ga0123357_10001023 | 3300009784 | Bacteria | 28712 |
| 67 | Ga0466703_004481 | 3300042636 | Bacteria | 1938 |
| 68 | Ga0466704_228862 | 3300042643 | Bacteria | 4279 |
| 69 | Ga0466724_08063 | 3300042649 | Bacteria | 1763 |
| 70 | Ga0466705_172006 | 3300042612 | Unclassified | 6250 |
| 71 | Ga0466733_106507 | 3300042659 | Bacteria | 5396 |
| 72 | Ga0466712_016345 | 3300042614 | Bacteria | 12564 |
| 73 | Ga0466712_307103 | 3300042614 | Bacteria | 7340 |
| 74 | Ga0466711_097899 | 3300042615 | Unclassified | 2981 |
| 75 | Ga0466715_084455 | 3300042616 | Bacteria | 2390 |
| 76 | Ga0466715_133942 | 3300042616 | Bacteria | 16228 |
| 77 | Ga0466715_153792 | 3300042616 | Bacteria | 13336 |
| 78 | Ga0466715_642064 | 3300042616 | Bacteria | 3210 |
| 79 | Ga0466718_020702 | 3300042617 | Bacteria | 14077 |
| 80 | Ga0466723_236858 | 3300042618 | Bacteria | 7845 |
| 81 | Ga0466723_364923 | 3300042618 | Bacteria | 2757 |
| 82 | Ga0265387_1003151 | 3300024582 | Bacteria | 2302 |
| 83 | Ga0415639_006610 | 3300038395 | Bacteria | 24388 |
| 84 | Ga0415639_006801 | 3300038395 | Bacteria | 4415 |
| 85 | Ga0415639_015065 | 3300038395 | Bacteria | 8876 |
| 86 | Ga0466696_440469 | 3300042596 | Bacteria | 9086 |
| 87 | Ga0466699_301188 | 3300042597 | Bacteria | 2141 |
| 88 | Ga0123357_10011127 | 3300009784 | Bacteria | 11511 |
| 89 | Ga0123357_10011455 | 3300009784 | Bacteria | 11377 |
| 90 | Ga0123355_10261843 | 3300009826 | Bacteria | 2417 |
| 91 | Ga0123356_10001944 | 3300010049 | Bacteria | 22372 |
| 92 | Ga0123356_10137085 | 3300010049 | Bacteria | 2408 |
| 93 | Ga0123353_10000119 | 3300010167 | Bacteria | 93234 |
| 94 | Ga0123353_10027858 | 3300010167 | Bacteria | 8666 |
| 95 | Ga0123353_10235353 | 3300010167 | Bacteria | 2851 |
| 96 | Ga0466706_001644 | 3300042599 | Bacteria | 23740 |
| 97 | Ga0466720_091327 | 3300042607 | Unclassified | 3869 |
| 98 | Ga0466720_109394 | 3300042607 | Bacteria | 2496 |
| 99 | Ga0466721_320012 | 3300042608 | Bacteria | 35455 |
| 100 | Ga0466722_040517 | 3300042609 | Bacteria | 23977 |
| 101 | Ga0466698_127988 | 3300042610 | Bacteria | 8444 |
| 102 | IMNBL1DRAFT_c0006785 | 3300000062 | Bacteria | 6175 |
| 103 | IMNBL1DRAFT_c0008830 | 3300000062 | Bacteria | 5077 |
| 104 | JGI24698J34947_10013247 | 3300002449 | Bacteria | 4505 |
| 105 | JGI24698J34947_10017256 | 3300002449 | Unclassified | 3914 |
| 106 | JGI24698J34947_10020950 | 3300002449 | Bacteria | 3520 |
| 107 | JGI24698J34947_10062853 | 3300002449 | Bacteria | 1822 |
| 108 | Ga0466730_070089 | 3300042625 | Bacteria | 5895 |
| 109 | Ga0466703_248198 | 3300042636 | Bacteria | 10890 |
| 110 | Ga0466732_205639 | 3300042656 | Bacteria | 13825 |
| 111 | Ga0466733_032009 | 3300042659 | Bacteria | 11832 |
| 112 | Ga0466733_182789 | 3300042659 | Bacteria | 10260 |
| 113 | Ga0466710_099204 | 3300042613 | Bacteria | 2421 |
| 114 | Ga0466712_212024 | 3300042614 | Bacteria | 18168 |
| 115 | Ga0466715_623371 | 3300042616 | Bacteria | 2113 |
| 116 | Ga0466728_470209 | 3300042620 | Bacteria | 3606 |
| 117 | Ga0415639_040023 | 3300038395 | Bacteria | 2783 |
| 118 | Ga0466690_246190 | 3300042590 | Bacteria | 1739 |
| 119 | Ga0466692_095679 | 3300042591 | Bacteria | 3798 |
| 120 | Ga0123355_10023071 | 3300009826 | Bacteria | 9987 |
| 121 | Ga0123355_10207265 | 3300009826 | Bacteria | 2849 |
| 122 | Ga0123356_10012086 | 3300010049 | Bacteria | 8394 |
| 123 | Ga0123356_10115258 | 3300010049 | Bacteria | 2603 |
| 124 | Ga0123353_10025446 | 3300010167 | Bacteria | 9019 |
| 125 | Ga0123353_10111957 | 3300010167 | Bacteria | 4396 |
| 126 | Ga0123353_10468259 | 3300010167 | Bacteria | 1849 |
| 127 | Ga0466706_084161 | 3300042599 | Unclassified | 2194 |
| 128 | Ga0466706_124934 | 3300042599 | Bacteria | 5450 |
| 129 | Ga0466706_278888 | 3300042599 | Archaea | 40638 |
| 130 | Ga0466700_414144 | 3300042600 | Bacteria | 4217 |
| 131 | Ga0466713_118999 | 3300042602 | Bacteria | 3068 |
| 132 | Ga0466714_127489 | 3300042603 | Bacteria | 2244 |
| 133 | Ga0466720_230111 | 3300042607 | Bacteria | 2176 |
| 134 | Ga0466721_179081 | 3300042608 | Bacteria | 14566 |
| 135 | Ga0466722_189957 | 3300042609 | Bacteria | 25160 |
| 136 | 2227638790 | 2225789004 | Bacteria | 2073 |
| 137 | JGI24703J35330_11748396 | 3300002501 | Bacteria | 15287 |
| 138 | Ga0068302_10091631 | 3300005071 | Bacteria | 4381 |
| 139 | Ga0466703_067793 | 3300042636 | Bacteria | 41172 |
| 140 | Ga0466704_025065 | 3300042643 | Bacteria | 12785 |
| 141 | Ga0466704_048780 | 3300042643 | Bacteria | 18515 |
| 142 | Ga0466708_148875 | 3300042652 | Bacteria | 14741 |
| 143 | Ga0466705_201568 | 3300042612 | Bacteria | 3269 |
| 144 | Ga0466705_472145 | 3300042612 | Bacteria | 33272 |
| 145 | Ga0466715_031452 | 3300042616 | Unclassified | 1918 |
| 146 | Ga0466718_150133 | 3300042617 | Bacteria | 19302 |
| 147 | Ga0466726_475805 | 3300042619 | Bacteria | 3512 |
| 148 | Ga0264413_120063 | 3300024493 | Unclassified | 2640 |
| 149 | Ga0466690_175209 | 3300042590 | Bacteria | 3504 |
| 150 | Ga0123355_10065612 | 3300009826 | Bacteria | 5847 |
| 151 | Ga0123355_10128271 | 3300009826 | Bacteria | 3914 |
| 152 | Ga0123356_10029009 | 3300010049 | Bacteria | 5184 |
| 153 | Ga0123353_10055366 | 3300010167 | Bacteria | 6345 |
| 154 | Ga0123353_10222753 | 3300010167 | Bacteria | 2948 |
| 155 | Ga0466706_065373 | 3300042599 | Bacteria | 10491 |
| 156 | Ga0466700_073782 | 3300042600 | Bacteria | 4638 |
| 157 | Ga0466707_327975 | 3300042601 | Bacteria | 12168 |
| 158 | Ga0466713_133559 | 3300042602 | Bacteria | 4680 |
| 159 | Ga0466716_221525 | 3300042605 | Bacteria | 2704 |
| 160 | Ga0466720_048698 | 3300042607 | Bacteria | 10626 |
| 161 | Ga0466720_063031 | 3300042607 | Bacteria | 13343 |
| 162 | AustNasuHG_c1002589 | 3300000089 | Bacteria | 6532 |
| 163 | JGI24698J34947_10004431 | 3300002449 | Bacteria | 7643 |
| 164 | JGI24698J34947_10020324 | 3300002449 | Bacteria | 3578 |
| 165 | JGI24703J35330_11746202 | 3300002501 | Bacteria | 5051 |
| 166 | Ga0466735_075073 | 3300042624 | Bacteria | 2108 |
| 167 | Ga0466704_055972 | 3300042643 | Bacteria | 1888 |
| 168 | Ga0466704_231866 | 3300042643 | Bacteria | 63702 |
| 169 | Ga0466705_350076 | 3300042612 | Bacteria | 4768 |
| 170 | Ga0466733_010123 | 3300042659 | Bacteria | 4221 |
| 171 | Ga0466712_113717 | 3300042614 | Bacteria | 3270 |
| 172 | Ga0466712_194284 | 3300042614 | Bacteria | 2685 |
| 173 | Ga0466711_272174 | 3300042615 | Bacteria | 4354 |
| 174 | Ga0466711_420532 | 3300042615 | Bacteria | 4536 |
| 175 | Ga0466723_204004 | 3300042618 | Bacteria | 2400 |
| 176 | Ga0466729_056413 | 3300042621 | Bacteria | 40886 |
| 177 | Ga0466690_086078 | 3300042590 | Bacteria | 11747 |
| 178 | Ga0466693_056109 | 3300042592 | Bacteria | 3329 |
| 179 | Ga0123355_10000028 | 3300009826 | Bacteria | 144673 |
| 180 | Ga0123355_10112004 | 3300009826 | Bacteria | 4260 |
| 181 | Ga0123354_10201805 | 3300010882 | Bacteria | 2183 |
| 182 | Ga0466719_089691 | 3300042606 | Bacteria | 2793 |
| 183 | Ga0466720_117540 | 3300042607 | Bacteria | 11507 |
| 184 | 2227520203 | 2225789004 | Bacteria | 3356 |
| 185 | JGI24698J34947_10003670 | 3300002449 | Bacteria | 8341 |
| 186 | JGI24695J34938_10003124 | 3300002450 | Bacteria | 11818 |
| 187 | Ga0072941_1199805 | 3300005201 | Bacteria | 2329 |
| 188 | Ga0466703_276473 | 3300042636 | Bacteria | 1989 |
| 189 | Ga0466708_194431 | 3300042652 | Bacteria | 3121 |
| 190 | Ga0466727_190694 | 3300042655 | Bacteria | 6144 |
| 191 | Ga0466733_056067 | 3300042659 | Bacteria | 1962 |
| 192 | Ga0466712_043604 | 3300042614 | Bacteria | 10968 |
| 193 | Ga0466715_336397 | 3300042616 | Bacteria | 25535 |
| 194 | Ga0415639_031806 | 3300038395 | Bacteria | 3149 |
| 195 | Ga0415639_062254 | 3300038395 | Bacteria | 4675 |
| 196 | Ga0466691_210063 | 3300042593 | Bacteria | 4661 |
| 197 | Ga0466694_371828 | 3300042594 | Bacteria | 14731 |
| 198 | Ga0123355_10054222 | 3300009826 | Bacteria | 6497 |
| 199 | Ga0123355_10213642 | 3300009826 | Bacteria | 2790 |
| 200 | Ga0123356_10052778 | 3300010049 | Unclassified | 3782 |
| 201 | Ga0123353_10026071 | 3300010167 | Bacteria | 8918 |
| 202 | Ga0123353_10036400 | 3300010167 | Bacteria | 7709 |
| 203 | Ga0466701_016351 | 3300042598 | Bacteria | 2525 |
| 204 | Ga0466701_075634 | 3300042598 | Bacteria | 3771 |
| 205 | Ga0466706_081182 | 3300042599 | Unclassified | 3630 |
| 206 | Ga0466706_202406 | 3300042599 | Bacteria | 15021 |
| 207 | Ga0466717_003470 | 3300042604 | Bacteria | 5389 |
| 208 | Ga0466717_215833 | 3300042604 | Bacteria | 2246 |
| 209 | JGI24695J34938_10018414 | 3300002450 | Bacteria | 3492 |
| 210 | JGI24702J35022_10005862 | 3300002462 | Bacteria | 7145 |
| 211 | JGI24703J35330_11748016 | 3300002501 | Bacteria | 9908 |
| 212 | Ga0466702_391511 | 3300042635 | Bacteria | 2337 |
| 213 | Ga0466702_408855 | 3300042635 | Bacteria | 2058 |
| 214 | Ga0466708_207554 | 3300042652 | Bacteria | 3934 |
| 215 | Ga0466708_211714 | 3300042652 | Bacteria | 12381 |
| 216 | Ga0466705_083298 | 3300042612 | Bacteria | 2344 |
| 217 | Ga0466705_285296 | 3300042612 | Bacteria | 6405 |
| 218 | Ga0466710_335016 | 3300042613 | Bacteria | 7762 |
| 219 | Ga0466711_157616 | 3300042615 | Bacteria | 4433 |
| 220 | Ga0466718_017638 | 3300042617 | Bacteria | 2979 |
| 221 | Ga0466723_069763 | 3300042618 | Bacteria | 3119 |
| 222 | Ga0466726_061346 | 3300042619 | Bacteria | 3513 |
| 223 | Ga0415639_045259 | 3300038395 | Unclassified | 3014 |
| 224 | Ga0466690_053253 | 3300042590 | Bacteria | 2191 |
| 225 | Ga0466693_013664 | 3300042592 | Bacteria | 1686 |
| 226 | Ga0123357_10015481 | 3300009784 | Bacteria | 10001 |
| 227 | Ga0123355_10005481 | 3300009826 | Bacteria | 18598 |
| 228 | Ga0123355_10142364 | 3300009826 | Bacteria | 3665 |
| 229 | Ga0123356_10068243 | 3300010049 | Bacteria | 3330 |
| 230 | Ga0123353_10038126 | 3300010167 | Bacteria | 7549 |
| 231 | Ga0466706_021858 | 3300042599 | Unclassified | 2477 |
| 232 | Ga0466706_103138 | 3300042599 | Bacteria | 8447 |
| 233 | Ga0466700_374269 | 3300042600 | Bacteria | 2756 |
| 234 | Ga0466716_331385 | 3300042605 | Bacteria | 4962 |
| 235 | Ga0466721_135084 | 3300042608 | Bacteria | 1888 |
| 236 | Ga0466722_053061 | 3300042609 | Bacteria | 1917 |
| 237 | 2227482997 | 2225789004 | Bacteria | 4367 |
| 238 | JGI24702J35022_10004024 | 3300002462 | Bacteria | 8805 |
| 239 | Ga0068302_10392765 | 3300005071 | Bacteria | 1748 |
| 240 | Ga0072940_1074284 | 3300005200 | Bacteria | 8551 |
| 241 | Ga0466735_041342 | 3300042624 | Bacteria | 17971 |
| 242 | Ga0466708_190707 | 3300042652 | Bacteria | 20881 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.