Protein Family IF02174
Metagenome
Isolate
370
Members
133
Samples
290
Scaffolds
253.81
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10004632|Ga0123357_100046324
- Length
- 267 aa
- Sequence
- MSTSPLIETPAEVPVRSGEQVIFKRPAALTSANFSYCPGCTHGVVHRLIAESLDELDVTDRAVGVAPVGCAVMAYDFFNIDMAQAAHGRASAVATGIKRARPDTIVFAYQGDGDLASIGTAETVHAATRGENITVIFINNAIYGMTGGQMAPTSLPGTAGFPIRVCEMLATLDGPALVQRVSVDSPKNIRQAKAAIKKAFRYQVDGVGYSIIEVISSCPTNWGLSPVAALDWLRDNMIPYYPLGVYKDIGADGQGSATAEMGDIHE*
Sample Types
Isolate
21.6%
Metagenome
78.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
53.8%
Termitidae
22.7%
Kalotermitidae
10.6%
Blattidae
3.8%
Rhinotermitidae
3.0%
Termopsidae
2.3%
Hydrophilidae
1.5%
Passalidae
1.5%
Hodotermitidae
0.8%
Taxonomy
Archaea
4
Bacteria
358
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 2 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 3 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 4 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 5 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 6 | 2820669764 | Unclassified Firmicutes Co191P3bin30 | Isolate | Unclassified |
| 7 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 8 | 2820730639 | Unclassified Chloroflexi Th196P4bin31 | Isolate | Unclassified |
| 9 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 10 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 13 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 20 | 2791354849 | Unclassified Chloroflexi Lab288P3bin29 | Isolate | Unclassified |
| 21 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 22 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 23 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 24 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 25 | 2820854745 | Unclassified Actinobacteria Lab288P3bin234 | Isolate | Unclassified |
| 26 | 2820921285 | Unclassified Actinobacteria Emb289P3bin53 | Isolate | Unclassified |
| 27 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 30 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 31 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 43 | 2791354848 | Unclassified Chloroflexi Emb289P3bin155 | Isolate | Unclassified |
| 44 | 2820023741 | Unclassified Spirochaetes Lab288P3bin165 | Isolate | Unclassified |
| 45 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 46 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 47 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 48 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 49 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 50 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 51 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 52 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 53 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 54 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 55 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 56 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 57 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 58 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 59 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 60 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 61 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 62 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 63 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 64 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 65 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 66 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 67 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 68 | 2820679524 | Unclassified Firmicutes Co191P1bin94 | Isolate | Unclassified |
| 69 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 70 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 71 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 72 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 73 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 74 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 75 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 76 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 77 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 78 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 79 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 80 | 2820401926 | Unclassified Firmicutes Mp193P1bin2 | Isolate | Unclassified |
| 81 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 82 | 2820426531 | Unclassified Firmicutes Lab288P3bin45 | Isolate | Unclassified |
| 83 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 84 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 85 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 86 | 2820806175 | Unclassified Actinobacteria Th196P3bin122 | Isolate | Unclassified |
| 87 | 2820852808 | Unclassified Actinobacteria Lab288P3bin25 | Isolate | Unclassified |
| 88 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 89 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 90 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 91 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 92 | 2820545146 | Unclassified Firmicutes Lab288P1bin104 | Isolate | Unclassified |
| 93 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 94 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 95 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 96 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 97 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 98 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 99 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 100 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 101 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 102 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 103 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 104 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 105 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 106 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 107 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 108 | 2773857686 | Unclassified Methanomassiliicoccaceae Lab288P4bin70 | Isolate | Unclassified |
| 109 | 2820094617 | Unclassified Proteobacteria Lab288P3bin216 | Isolate | Unclassified |
| 110 | 2820856540 | Unclassified Actinobacteria Lab288P3bin21 | Isolate | Unclassified |
| 111 | 2820874551 | Unclassified Actinobacteria Lab288P1bin85 | Isolate | Unclassified |
| 112 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 113 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 114 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 115 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 116 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 117 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 118 | 2820323050 | Unclassified Firmicutes Nt197P3bin84 | Isolate | Unclassified |
| 119 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 120 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 121 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 122 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 123 | 2820729191 | Unclassified Chloroflexi Th196P4bin49 | Isolate | Unclassified |
| 124 | 2820731983 | Unclassified Chloroflexi Nt197P3bin126 | Isolate | Unclassified |
| 125 | 2820734335 | Unclassified Chloroflexi Lab288P3bin99 | Isolate | Unclassified |
| 126 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 127 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 128 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 129 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 130 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 131 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 132 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 133 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_005931 | 3300038395 | Bacteria | 7610 |
| 2 | Ga0415639_009798 | 3300038395 | Bacteria | 17327 |
| 3 | Ga0466692_061431 | 3300042591 | Bacteria | 6922 |
| 4 | Ga0466692_107783 | 3300042591 | Bacteria | 51155 |
| 5 | Ga0466696_023449 | 3300042596 | Bacteria | 4358 |
| 6 | Ga0466733_184413 | 3300042659 | Bacteria | 1780 |
| 7 | Ga0466733_190486 | 3300042659 | Bacteria | 10295 |
| 8 | Ga0466710_129583 | 3300042613 | Bacteria | 6585 |
| 9 | Ga0466711_142779 | 3300042615 | Bacteria | 2102 |
| 10 | Ga0466718_068695 | 3300042617 | Bacteria | 3363 |
| 11 | Ga0466723_076878 | 3300042618 | Bacteria | 14819 |
| 12 | Ga0466726_180512 | 3300042619 | Bacteria | 47141 |
| 13 | Ga0123357_10102333 | 3300009784 | Bacteria | 3688 |
| 14 | Ga0123357_10307562 | 3300009784 | Bacteria | 1589 |
| 15 | Ga0123355_10008040 | 3300009826 | Bacteria | 15904 |
| 16 | Ga0123355_10024305 | 3300009826 | Bacteria | 9739 |
| 17 | Ga0123355_10208238 | 3300009826 | Bacteria | 2841 |
| 18 | Ga0123356_10004472 | 3300010049 | Bacteria | 14442 |
| 19 | Ga0123356_10481905 | 3300010049 | Bacteria | 1394 |
| 20 | Ga0123353_10021534 | 3300010167 | Bacteria | 9679 |
| 21 | Ga0123353_10029340 | 3300010167 | Bacteria | 8475 |
| 22 | Ga0123353_10042537 | 3300010167 | Bacteria | 7185 |
| 23 | Ga0123353_10051729 | 3300010167 | Bacteria | 6556 |
| 24 | Ga0123353_10051730 | 3300010167 | Bacteria | 6556 |
| 25 | Ga0123353_10165551 | 3300010167 | Bacteria | 3515 |
| 26 | Ga0123353_10173429 | 3300010167 | Bacteria | 3421 |
| 27 | Ga0123354_10029747 | 3300010882 | Bacteria | 8586 |
| 28 | Ga0123354_10135628 | 3300010882 | Bacteria | 3080 |
| 29 | Ga0466706_036494 | 3300042599 | Bacteria | 4260 |
| 30 | Ga0466706_156744 | 3300042599 | Bacteria | 14182 |
| 31 | Ga0466706_204563 | 3300042599 | Unclassified | 2303 |
| 32 | Ga0466706_270103 | 3300042599 | Bacteria | 2349 |
| 33 | Ga0466707_341341 | 3300042601 | Bacteria | 164517 |
| 34 | Ga0466713_087589 | 3300042602 | Bacteria | 51470 |
| 35 | Ga0466714_165847 | 3300042603 | Bacteria | 1155 |
| 36 | Ga0466731_372742 | 3300042622 | Bacteria | 2502 |
| 37 | Ga0466702_466724 | 3300042635 | Bacteria | 1826 |
| 38 | Ga0466704_568987 | 3300042643 | Bacteria | 4816 |
| 39 | Ga0466725_009950 | 3300042654 | Bacteria | 52916 |
| 40 | Ga0466727_273117 | 3300042655 | Bacteria | 7884 |
| 41 | Ga0415639_033733 | 3300038395 | Bacteria | 5178 |
| 42 | Ga0466657_145047 | 3300042582 | Bacteria | 1604 |
| 43 | Ga0466692_154738 | 3300042591 | Bacteria | 2429 |
| 44 | IMNBL1DRAFT_c0018210 | 3300000062 | Bacteria | 2926 |
| 45 | IMNBL1DRAFT_c0019408 | 3300000062 | Bacteria | 2786 |
| 46 | JGI24695J34938_10000022 | 3300002450 | Bacteria | 111549 |
| 47 | JGI24702J35022_10015189 | 3300002462 | Bacteria | 4241 |
| 48 | JGI24702J35022_10208839 | 3300002462 | Bacteria | 1120 |
| 49 | JGI24696J40584_12961662 | 3300002834 | Archaea | 30438 |
| 50 | Ga0072940_1352834 | 3300005200 | Bacteria | 1689 |
| 51 | Ga0123357_10001203 | 3300009784 | Archaea | 27053 |
| 52 | Ga0466705_063520 | 3300042612 | Bacteria | 2262 |
| 53 | Ga0466715_245290 | 3300042616 | Bacteria | 2601 |
| 54 | Ga0466715_279781 | 3300042616 | Bacteria | 3119 |
| 55 | Ga0466718_138919 | 3300042617 | Bacteria | 7013 |
| 56 | Ga0466723_055550 | 3300042618 | Bacteria | 3524 |
| 57 | Ga0466726_374408 | 3300042619 | Bacteria | 1508 |
| 58 | Ga0123355_10004825 | 3300009826 | Bacteria | 19629 |
| 59 | Ga0123355_10039354 | 3300009826 | Bacteria | 7692 |
| 60 | Ga0123355_10081943 | 3300009826 | Bacteria | 5148 |
| 61 | Ga0123355_10303540 | 3300009826 | Bacteria | 2173 |
| 62 | Ga0123355_10360856 | 3300009826 | Bacteria | 1914 |
| 63 | Ga0123355_10438130 | 3300009826 | Bacteria | 1657 |
| 64 | Ga0123355_10454293 | 3300009826 | Bacteria | 1612 |
| 65 | Ga0123356_10001222 | 3300010049 | Bacteria | 28515 |
| 66 | Ga0123356_10003755 | 3300010049 | Bacteria | 15827 |
| 67 | Ga0123356_10013040 | 3300010049 | Bacteria | 8040 |
| 68 | Ga0123356_10165745 | 3300010049 | Bacteria | 2213 |
| 69 | Ga0123356_10435673 | 3300010049 | Bacteria | 1456 |
| 70 | Ga0123353_10000855 | 3300010167 | Bacteria | 37005 |
| 71 | Ga0123354_10302922 | 3300010882 | Bacteria | 1508 |
| 72 | Ga0123354_10350735 | 3300010882 | Unclassified | 1316 |
| 73 | Ga0466701_078368 | 3300042598 | Bacteria | 2381 |
| 74 | Ga0466706_059420 | 3300042599 | Bacteria | 3214 |
| 75 | Ga0466706_164052 | 3300042599 | Bacteria | 208763 |
| 76 | Ga0466706_258442 | 3300042599 | Bacteria | 8168 |
| 77 | Ga0466707_402638 | 3300042601 | Bacteria | 23456 |
| 78 | Ga0466714_127961 | 3300042603 | Bacteria | 26473 |
| 79 | Ga0466719_293808 | 3300042606 | Bacteria | 3344 |
| 80 | Ga0466722_074716 | 3300042609 | Bacteria | 6747 |
| 81 | Ga0466729_249615 | 3300042621 | Bacteria | 4550 |
| 82 | Ga0415639_004978 | 3300038395 | Bacteria | 28196 |
| 83 | Ga0466695_150620 | 3300042595 | Bacteria | 1544 |
| 84 | JGI24702J35022_10000090 | 3300002462 | Bacteria | 40711 |
| 85 | JGI24702J35022_10002880 | 3300002462 | Bacteria | 10413 |
| 86 | JGI24702J35022_10030228 | 3300002462 | Bacteria | 2907 |
| 87 | JGI24702J35022_10249948 | 3300002462 | Bacteria | 1031 |
| 88 | JGI24696J40584_12958286 | 3300002834 | Bacteria | 4010 |
| 89 | Ga0466715_213702 | 3300042616 | Bacteria | 1187 |
| 90 | Ga0466718_020626 | 3300042617 | Bacteria | 2413 |
| 91 | Ga0466718_030223 | 3300042617 | Bacteria | 4664 |
| 92 | Ga0466726_130446 | 3300042619 | Bacteria | 44133 |
| 93 | Ga0466728_387766 | 3300042620 | Bacteria | 2340 |
| 94 | Ga0123355_10611074 | 3300009826 | Bacteria | 1289 |
| 95 | Ga0123356_10007323 | 3300010049 | Bacteria | 11010 |
| 96 | Ga0123356_10064846 | 3300010049 | Bacteria | 3416 |
| 97 | Ga0123356_10245408 | 3300010049 | Bacteria | 1865 |
| 98 | Ga0123356_10921637 | 3300010049 | Bacteria | 1045 |
| 99 | Ga0123353_10013643 | 3300010167 | Bacteria | 11651 |
| 100 | Ga0123353_10015328 | 3300010167 | Bacteria | 11125 |
| 101 | Ga0123353_10043220 | 3300010167 | Bacteria | 7138 |
| 102 | Ga0466700_449155 | 3300042600 | Bacteria | 1230 |
| 103 | Ga0466707_019065 | 3300042601 | Bacteria | 75577 |
| 104 | Ga0466714_083082 | 3300042603 | Bacteria | 1329 |
| 105 | Ga0466714_134909 | 3300042603 | Bacteria | 2408 |
| 106 | Ga0466716_241795 | 3300042605 | Bacteria | 1016 |
| 107 | Ga0466696_104051 | 3300042596 | Bacteria | 2230 |
| 108 | Ga0466696_424699 | 3300042596 | Bacteria | 3108 |
| 109 | IMNBL1DRAFT_c0000107 | 3300000062 | Bacteria | 74044 |
| 110 | JGI24705J35276_12231045 | 3300002504 | Bacteria | 3811 |
| 111 | Ga0072941_1202651 | 3300005201 | Bacteria | 16810 |
| 112 | Ga0466705_471564 | 3300042612 | Bacteria | 28580 |
| 113 | Ga0466705_516041 | 3300042612 | Bacteria | 59222 |
| 114 | Ga0466710_430819 | 3300042613 | Bacteria | 1215 |
| 115 | Ga0466715_493826 | 3300042616 | Bacteria | 7188 |
| 116 | Ga0466728_292124 | 3300042620 | Bacteria | 42090 |
| 117 | Ga0466729_168296 | 3300042621 | Bacteria | 14413 |
| 118 | Ga0123357_10004632 | 3300009784 | Bacteria | 16223 |
| 119 | Ga0123355_10188667 | 3300009826 | Bacteria | 3042 |
| 120 | Ga0123355_10220903 | 3300009826 | Bacteria | 2725 |
| 121 | Ga0123356_10035815 | 3300010049 | Bacteria | 4634 |
| 122 | Ga0123356_10037799 | 3300010049 | Bacteria | 4501 |
| 123 | Ga0123356_10060625 | 3300010049 | Bacteria | 3531 |
| 124 | Ga0123356_10321083 | 3300010049 | Bacteria | 1661 |
| 125 | Ga0123353_10006881 | 3300010167 | Bacteria | 15267 |
| 126 | Ga0123353_10029218 | 3300010167 | Bacteria | 8491 |
| 127 | Ga0123353_10043364 | 3300010167 | Bacteria | 7125 |
| 128 | Ga0123353_10144299 | 3300010167 | Bacteria | 3809 |
| 129 | Ga0123353_10357529 | 3300010167 | Bacteria | 2196 |
| 130 | Ga0123353_10729851 | 3300010167 | Bacteria | 1383 |
| 131 | Ga0123353_11181116 | 3300010167 | Bacteria | 1006 |
| 132 | Ga0123354_10071223 | 3300010882 | Bacteria | 5020 |
| 133 | Ga0466706_001485 | 3300042599 | Bacteria | 8842 |
| 134 | Ga0466706_120432 | 3300042599 | Bacteria | 12087 |
| 135 | Ga0466706_193239 | 3300042599 | Bacteria | 4610 |
| 136 | Ga0466713_043605 | 3300042602 | Bacteria | 65246 |
| 137 | Ga0466714_022340 | 3300042603 | Bacteria | 1474 |
| 138 | Ga0466722_143926 | 3300042609 | Bacteria | 19686 |
| 139 | Ga0466735_003688 | 3300042624 | Bacteria | 1135 |
| 140 | Ga0466725_195223 | 3300042654 | Bacteria | 4508 |
| 141 | Ga0415639_001309 | 3300038395 | Bacteria | 13702 |
| 142 | Ga0415639_027630 | 3300038395 | Bacteria | 14791 |
| 143 | Ga0415639_092268 | 3300038395 | Bacteria | 5062 |
| 144 | Ga0466701_003755 | 3300042598 | Bacteria | 3570 |
| 145 | 2227640171 | 2225789004 | Bacteria | 2065 |
| 146 | IMNBL1DRAFT_c0001485 | 3300000062 | Bacteria | 17482 |
| 147 | JGI24702J35022_10001756 | 3300002462 | Bacteria | 13398 |
| 148 | JGI24702J35022_10010918 | 3300002462 | Bacteria | 5068 |
| 149 | JGI24702J35022_10113428 | 3300002462 | Bacteria | 1492 |
| 150 | JGI24705J35276_12227203 | 3300002504 | Bacteria | 2963 |
| 151 | Ga0072941_1153024 | 3300005201 | Bacteria | 6952 |
| 152 | Ga0466697_213154 | 3300042611 | Bacteria | 3701 |
| 153 | Ga0466710_158181 | 3300042613 | Bacteria | 12935 |
| 154 | Ga0466711_043594 | 3300042615 | Bacteria | 4540 |
| 155 | Ga0466711_434408 | 3300042615 | Bacteria | 4458 |
| 156 | Ga0466711_492858 | 3300042615 | Bacteria | 3792 |
| 157 | Ga0466715_034882 | 3300042616 | Bacteria | 6149 |
| 158 | Ga0466715_513990 | 3300042616 | Bacteria | 111655 |
| 159 | Ga0123357_10135837 | 3300009784 | Bacteria | 3043 |
| 160 | Ga0123355_10001252 | 3300009826 | Bacteria | 35438 |
| 161 | Ga0123355_10122495 | 3300009826 | Bacteria | 4029 |
| 162 | Ga0123355_10139778 | 3300009826 | Bacteria | 3709 |
| 163 | Ga0123355_10402183 | 3300009826 | Bacteria | 1765 |
| 164 | Ga0123356_10013470 | 3300010049 | Bacteria | 7891 |
| 165 | Ga0123356_10021054 | 3300010049 | Bacteria | 6167 |
| 166 | Ga0123356_10080461 | 3300010049 | Unclassified | 3081 |
| 167 | Ga0123356_10819904 | 3300010049 | Bacteria | 1102 |
| 168 | Ga0123353_10009070 | 3300010167 | Bacteria | 13674 |
| 169 | Ga0466706_053092 | 3300042599 | Bacteria | 3089 |
| 170 | Ga0466706_077233 | 3300042599 | Bacteria | 2339 |
| 171 | Ga0466706_184294 | 3300042599 | Bacteria | 37254 |
| 172 | Ga0466706_204365 | 3300042599 | Bacteria | 87849 |
| 173 | Ga0466714_147453 | 3300042603 | Unclassified | 1795 |
| 174 | Ga0466716_138413 | 3300042605 | Bacteria | 6331 |
| 175 | Ga0466716_458259 | 3300042605 | Bacteria | 4042 |
| 176 | Ga0466698_448637 | 3300042610 | Bacteria | 13647 |
| 177 | Ga0466731_268416 | 3300042622 | Bacteria | 2693 |
| 178 | Ga0415639_003475 | 3300038395 | Bacteria | 16871 |
| 179 | Ga0415639_009527 | 3300038395 | Bacteria | 6784 |
| 180 | Ga0466691_202188 | 3300042593 | Bacteria | 30037 |
| 181 | Ga0466694_175220 | 3300042594 | Bacteria | 2566 |
| 182 | Ga0466694_261601 | 3300042594 | Bacteria | 8982 |
| 183 | Ga0466699_165713 | 3300042597 | Bacteria | 3382 |
| 184 | Ga0466733_176526 | 3300042659 | Bacteria | 102706 |
| 185 | IMNBL1DRAFT_c0003364 | 3300000062 | Bacteria | 10372 |
| 186 | JGI24695J34938_10000351 | 3300002450 | Bacteria | 45430 |
| 187 | JGI24702J35022_10004320 | 3300002462 | Bacteria | 8472 |
| 188 | Ga0072940_1027809 | 3300005200 | Bacteria | 6658 |
| 189 | Ga0072941_1390745 | 3300005201 | Bacteria | 1217 |
| 190 | Ga0466705_009982 | 3300042612 | Bacteria | 11629 |
| 191 | Ga0466705_223360 | 3300042612 | Bacteria | 3083 |
| 192 | Ga0466705_316182 | 3300042612 | Bacteria | 5928 |
| 193 | Ga0466723_184390 | 3300042618 | Bacteria | 3970 |
| 194 | Ga0466726_280742 | 3300042619 | Bacteria | 10083 |
| 195 | Ga0123357_10107088 | 3300009784 | Bacteria | 3581 |
| 196 | Ga0123355_10146171 | 3300009826 | Bacteria | 3604 |
| 197 | Ga0123355_10240848 | 3300009826 | Bacteria | 2563 |
| 198 | Ga0123355_10397418 | 3300009826 | Bacteria | 1781 |
| 199 | Ga0123356_10002796 | 3300010049 | Bacteria | 18499 |
| 200 | Ga0123356_10194704 | 3300010049 | Bacteria | 2061 |
| 201 | Ga0123353_10001270 | 3300010167 | Bacteria | 30918 |
| 202 | Ga0123353_10021310 | 3300010167 | Bacteria | 9724 |
| 203 | Ga0123353_10031523 | 3300010167 | Bacteria | 8212 |
| 204 | Ga0123353_10048375 | 3300010167 | Bacteria | 6771 |
| 205 | Ga0123353_10103060 | 3300010167 | Bacteria | 4599 |
| 206 | Ga0123353_10119247 | 3300010167 | Bacteria | 4243 |
| 207 | Ga0123353_10383231 | 3300010167 | Bacteria | 2102 |
| 208 | Ga0123353_11002750 | 3300010167 | Bacteria | 1122 |
| 209 | Ga0123354_10323924 | 3300010882 | Bacteria | 1417 |
| 210 | Ga0466706_276918 | 3300042599 | Bacteria | 1301 |
| 211 | Ga0466707_136862 | 3300042601 | Unclassified | 2908 |
| 212 | Ga0466714_092677 | 3300042603 | Bacteria | 1869 |
| 213 | Ga0466714_148513 | 3300042603 | Bacteria | 4059 |
| 214 | Ga0466721_117067 | 3300042608 | Bacteria | 2743 |
| 215 | Ga0466722_006169 | 3300042609 | Bacteria | 8290 |
| 216 | Ga0466722_216740 | 3300042609 | Bacteria | 1742 |
| 217 | Ga0466704_438056 | 3300042643 | Bacteria | 1735 |
| 218 | Ga0466704_578252 | 3300042643 | Bacteria | 11375 |
| 219 | Ga0466656_241632 | 3300042550 | Bacteria | 2380 |
| 220 | Ga0466690_401378 | 3300042590 | Bacteria | 3742 |
| 221 | IMNBL1DRAFT_c0011829 | 3300000062 | Bacteria | 4042 |
| 222 | JGI24702J35022_10003173 | 3300002462 | Bacteria | 9942 |
| 223 | Ga0466705_373275 | 3300042612 | Bacteria | 62368 |
| 224 | Ga0466705_451017 | 3300042612 | Bacteria | 11699 |
| 225 | Ga0466718_144735 | 3300042617 | Bacteria | 1064 |
| 226 | Ga0466726_034473 | 3300042619 | Bacteria | 2272 |
| 227 | Ga0123355_10000088 | 3300009826 | Bacteria | 97566 |
| 228 | Ga0123355_10002557 | 3300009826 | Bacteria | 25785 |
| 229 | Ga0123355_10005493 | 3300009826 | Bacteria | 18580 |
| 230 | Ga0123355_10371200 | 3300009826 | Bacteria | 1874 |
| 231 | Ga0123356_10000760 | 3300010049 | Bacteria | 35664 |
| 232 | Ga0123356_10004295 | 3300010049 | Bacteria | 14743 |
| 233 | Ga0123356_10033638 | 3300010049 | Bacteria | 4794 |
| 234 | Ga0123356_10615035 | 3300010049 | Bacteria | 1252 |
| 235 | Ga0123356_10832903 | 3300010049 | Bacteria | 1094 |
| 236 | Ga0123353_10000574 | 3300010167 | Bacteria | 44995 |
| 237 | Ga0123353_10232679 | 3300010167 | Unclassified | 2871 |
| 238 | Ga0123353_10789898 | 3300010167 | Bacteria | 1313 |
| 239 | Ga0466706_013546 | 3300042599 | Bacteria | 1550 |
| 240 | Ga0466706_094702 | 3300042599 | Bacteria | 54816 |
| 241 | Ga0466706_104076 | 3300042599 | Bacteria | 1731 |
| 242 | Ga0466706_200095 | 3300042599 | Bacteria | 2330 |
| 243 | Ga0466706_270213 | 3300042599 | Bacteria | 1637 |
| 244 | Ga0466713_039124 | 3300042602 | Bacteria | 37710 |
| 245 | Ga0466713_047571 | 3300042602 | Bacteria | 55256 |
| 246 | Ga0466714_059595 | 3300042603 | Bacteria | 3728 |
| 247 | Ga0466714_117439 | 3300042603 | Bacteria | 74258 |
| 248 | Ga0466722_064576 | 3300042609 | Bacteria | 2146 |
| 249 | Ga0466735_052273 | 3300042624 | Bacteria | 7940 |
| 250 | Ga0466703_257020 | 3300042636 | Bacteria | 22088 |
| 251 | Ga0466704_536444 | 3300042643 | Bacteria | 1081 |
| 252 | Ga0466708_467090 | 3300042652 | Bacteria | 8800 |
| 253 | Ga0466725_410241 | 3300042654 | Bacteria | 3350 |
| 254 | Ga0415639_002454 | 3300038395 | Bacteria | 14965 |
| 255 | Ga0415639_112267 | 3300038395 | Bacteria | 3571 |
| 256 | Ga0466692_155903 | 3300042591 | Bacteria | 21891 |
| 257 | JGI24702J35022_10035132 | 3300002462 | Bacteria | 2680 |
| 258 | JGI24705J35276_12203869 | 3300002504 | Bacteria | 1665 |
| 259 | Ga0466697_059631 | 3300042611 | Bacteria | 9397 |
| 260 | Ga0466705_286694 | 3300042612 | Bacteria | 89956 |
| 261 | Ga0466715_456493 | 3300042616 | Bacteria | 86871 |
| 262 | Ga0466715_458307 | 3300042616 | Bacteria | 1428 |
| 263 | Ga0466728_485549 | 3300042620 | Bacteria | 1856 |
| 264 | Ga0123355_10000051 | 3300009826 | Bacteria | 119634 |
| 265 | Ga0123355_10418036 | 3300009826 | Bacteria | 1715 |
| 266 | Ga0123355_10563516 | 3300009826 | Bacteria | 1371 |
| 267 | Ga0123356_10024969 | 3300010049 | Bacteria | 5616 |
| 268 | Ga0123356_10048381 | 3300010049 | Bacteria | 3957 |
| 269 | Ga0123356_10069694 | 3300010049 | Bacteria | 3298 |
| 270 | Ga0123356_10365102 | 3300010049 | Bacteria | 1572 |
| 271 | Ga0123356_10963144 | 3300010049 | Bacteria | 1024 |
| 272 | Ga0123356_11294179 | 3300010049 | Bacteria | 892 |
| 273 | Ga0123353_10000650 | 3300010167 | Bacteria | 42532 |
| 274 | Ga0123353_10001336 | 3300010167 | Archaea | 30223 |
| 275 | Ga0123353_10010673 | 3300010167 | Bacteria | 12838 |
| 276 | Ga0123353_10049385 | 3300010167 | Bacteria | 6702 |
| 277 | Ga0123353_10351669 | 3300010167 | Bacteria | 2220 |
| 278 | Ga0466706_056542 | 3300042599 | Bacteria | 19104 |
| 279 | Ga0466706_119680 | 3300042599 | Bacteria | 15959 |
| 280 | Ga0466706_141838 | 3300042599 | Unclassified | 3112 |
| 281 | Ga0466706_226395 | 3300042599 | Unclassified | 3772 |
| 282 | Ga0466707_216727 | 3300042601 | Bacteria | 7013 |
| 283 | Ga0466713_006978 | 3300042602 | Bacteria | 198429 |
| 284 | Ga0466713_127351 | 3300042602 | Bacteria | 2103 |
| 285 | Ga0466714_101649 | 3300042603 | Bacteria | 8511 |
| 286 | Ga0466719_136826 | 3300042606 | Bacteria | 3818 |
| 287 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 288 | Ga0466730_076180 | 3300042625 | Bacteria | 3323 |
| 289 | Ga0466703_005857 | 3300042636 | Bacteria | 14027 |
| 290 | Ga0466703_217941 | 3300042636 | Bacteria | 2985 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02775 | TPP_enzyme_C | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain | 69 | 213 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.