Protein Family IF02158
Metagenome
Isolate
168
Members
71
Samples
143
Scaffolds
122.82
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10001046|Ga0123357_1000104619
- Length
- 143 aa
- Sequence
- VPIPFFIYFADYLAVSKKNNMKFLGNIIWLLFGGLLIAIEYFVASLLLMITIIGIPFGVQTLKLAILALWPFGSRVTDGGNSGGCLSVIMNVIWILIGGIWICLSHLIFGLFLCITVIGIPFGLQHFKMAALALTPFGKKIV*
Sample Types
Isolate
14.9%
Metagenome
85.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
28.6%
Termitidae
25.7%
Kalotermitidae
20.0%
Unclassified
11.4%
Rhinotermitidae
4.3%
Passalidae
4.3%
Termopsidae
4.3%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
158
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 2 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 12 | 2820873081 | Unclassified Actinobacteria Lab288P1bin96 | Isolate | Unclassified |
| 13 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 14 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 15 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 16 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 17 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2820870086 | Unclassified Actinobacteria Lab288P3bin107 | Isolate | Unclassified |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 37 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 38 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 43 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 44 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 45 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 46 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 47 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 48 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 49 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 50 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 51 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 52 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 53 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 54 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 55 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 56 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 57 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 58 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 59 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 60 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 61 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 62 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 63 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 64 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 65 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 66 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 67 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 68 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 69 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 70 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 71 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_12062609 | 3300010167 | Unclassified | 696 |
| 2 | Ga0466692_105100 | 3300042591 | Unclassified | 5340 |
| 3 | Ga0466701_029840 | 3300042598 | Bacteria | 102818 |
| 4 | Ga0466706_172865 | 3300042599 | Bacteria | 71053 |
| 5 | Ga0466706_229539 | 3300042599 | Bacteria | 2048 |
| 6 | Ga0466700_261223 | 3300042600 | Bacteria | 1374 |
| 7 | Ga0466707_087930 | 3300042601 | Bacteria | 9677 |
| 8 | Ga0466707_352233 | 3300042601 | Bacteria | 2608 |
| 9 | Ga0466713_077669 | 3300042602 | Bacteria | 61043 |
| 10 | Ga0466714_077793 | 3300042603 | Unclassified | 1601 |
| 11 | Ga0466716_132536 | 3300042605 | Bacteria | 38589 |
| 12 | Ga0466716_201409 | 3300042605 | Bacteria | 12199 |
| 13 | Ga0466719_176158 | 3300042606 | Bacteria | 3644 |
| 14 | Ga0466729_231174 | 3300042621 | Bacteria | 13478 |
| 15 | Ga0466703_063666 | 3300042636 | Bacteria | 16992 |
| 16 | Ga0466703_403169 | 3300042636 | Bacteria | 2102 |
| 17 | Ga0466704_205445 | 3300042643 | Bacteria | 2028 |
| 18 | JGI24702J35022_10415500 | 3300002462 | Bacteria | 814 |
| 19 | JGI24699J35502_11022660 | 3300002509 | Bacteria | 1461 |
| 20 | Ga0068305_10044185 | 3300005083 | Bacteria | 16880 |
| 21 | Ga0068305_10119077 | 3300005083 | Unclassified | 7835 |
| 22 | Ga0466705_430128 | 3300042612 | Bacteria | 3699 |
| 23 | Ga0466726_265695 | 3300042619 | Bacteria | 14378 |
| 24 | Ga0123356_10685191 | 3300010049 | Bacteria | 1193 |
| 25 | Ga0123356_12848666 | 3300010049 | Bacteria | 605 |
| 26 | Ga0123353_10343662 | 3300010167 | Bacteria | 2253 |
| 27 | Ga0466656_047168 | 3300042550 | Bacteria | 1524 |
| 28 | Ga0466692_095605 | 3300042591 | Bacteria | 21856 |
| 29 | Ga0466706_113818 | 3300042599 | Unclassified | 2477 |
| 30 | Ga0466713_056102 | 3300042602 | Bacteria | 4762 |
| 31 | Ga0466722_084309 | 3300042609 | Bacteria | 46740 |
| 32 | Ga0466722_106485 | 3300042609 | Bacteria | 12243 |
| 33 | Ga0466734_110269 | 3300042623 | Bacteria | 2150 |
| 34 | Ga0466703_402296 | 3300042636 | Bacteria | 9318 |
| 35 | Ga0466704_051687 | 3300042643 | Bacteria | 6534 |
| 36 | Ga0466709_339960 | 3300042648 | Bacteria | 31037 |
| 37 | IMNBL1DRAFT_c0011881 | 3300000062 | Bacteria | 4027 |
| 38 | JGI24702J35022_10308822 | 3300002462 | Bacteria | 935 |
| 39 | Ga0466711_177833 | 3300042615 | Bacteria | 4077 |
| 40 | Ga0123357_10576018 | 3300009784 | Bacteria | 880 |
| 41 | Ga0123357_10586924 | 3300009784 | Unclassified | 864 |
| 42 | Ga0123354_10000165 | 3300010882 | Bacteria | 53803 |
| 43 | Ga0265387_1031986 | 3300024582 | Bacteria | 857 |
| 44 | Ga0265387_1032667 | 3300024582 | Bacteria | 851 |
| 45 | Ga0466693_221163 | 3300042592 | Bacteria | 1128 |
| 46 | Ga0466691_054584 | 3300042593 | Bacteria | 5030 |
| 47 | Ga0466706_146215 | 3300042599 | Bacteria | 5508 |
| 48 | Ga0466707_068056 | 3300042601 | Bacteria | 3282 |
| 49 | Ga0466719_006809 | 3300042606 | Bacteria | 24772 |
| 50 | Ga0466733_034911 | 3300042659 | Bacteria | 5538 |
| 51 | Ga0466733_179584 | 3300042659 | Bacteria | 84251 |
| 52 | Ga0466733_181941 | 3300042659 | Bacteria | 3577 |
| 53 | Ga0466733_216252 | 3300042659 | Bacteria | 4332 |
| 54 | Ga0466705_132816 | 3300042612 | Bacteria | 2516 |
| 55 | Ga0466703_083927 | 3300042636 | Bacteria | 22876 |
| 56 | Ga0466703_299666 | 3300042636 | Bacteria | 4911 |
| 57 | Ga0466704_275384 | 3300042643 | Bacteria | 5692 |
| 58 | 2227097468 | 2225789004 | Bacteria | 9705 |
| 59 | 2227535714 | 2225789004 | Bacteria | 63282 |
| 60 | JGI24702J35022_10035423 | 3300002462 | Bacteria | 2669 |
| 61 | Ga0466711_242214 | 3300042615 | Bacteria | 21583 |
| 62 | Ga0466723_028729 | 3300042618 | Bacteria | 46525 |
| 63 | Ga0466726_333901 | 3300042619 | Bacteria | 3159 |
| 64 | Ga0123353_10452838 | 3300010167 | Bacteria | 1889 |
| 65 | Ga0123354_10003756 | 3300010882 | Bacteria | 21142 |
| 66 | Ga0123354_10034370 | 3300010882 | Bacteria | 7928 |
| 67 | Ga0123354_10122590 | 3300010882 | Bacteria | 3344 |
| 68 | Ga0265387_1018372 | 3300024582 | Bacteria | 1023 |
| 69 | Ga0466690_054770 | 3300042590 | Bacteria | 11371 |
| 70 | Ga0466706_031187 | 3300042599 | Bacteria | 4303 |
| 71 | Ga0466706_202427 | 3300042599 | Bacteria | 1071 |
| 72 | Ga0466714_069844 | 3300042603 | Bacteria | 3906 |
| 73 | Ga0466722_043266 | 3300042609 | Bacteria | 1142 |
| 74 | Ga0466722_265628 | 3300042609 | Bacteria | 51325 |
| 75 | Ga0466697_208983 | 3300042611 | Bacteria | 1712 |
| 76 | Ga0466704_512771 | 3300042643 | Bacteria | 9386 |
| 77 | Ga0466709_181337 | 3300042648 | Bacteria | 2520 |
| 78 | 2227566880 | 2225789004 | Bacteria | 2659 |
| 79 | IMNBL1DRAFT_c0000079 | 3300000062 | Bacteria | 87281 |
| 80 | IMNBL1DRAFT_c0010008 | 3300000062 | Bacteria | 4599 |
| 81 | JGI24702J35022_10429268 | 3300002462 | Bacteria | 802 |
| 82 | Ga0466711_077353 | 3300042615 | Bacteria | 5346 |
| 83 | Ga0466729_108976 | 3300042621 | Bacteria | 26843 |
| 84 | Ga0123356_10018419 | 3300010049 | Bacteria | 6630 |
| 85 | Ga0123353_10002004 | 3300010167 | Bacteria | 25166 |
| 86 | Ga0123353_10779820 | 3300010167 | Bacteria | 1324 |
| 87 | Ga0123353_11547470 | 3300010167 | Bacteria | 841 |
| 88 | Ga0466692_046888 | 3300042591 | Bacteria | 170448 |
| 89 | Ga0466696_015438 | 3300042596 | Bacteria | 18101 |
| 90 | Ga0466706_035083 | 3300042599 | Bacteria | 13471 |
| 91 | Ga0466706_205721 | 3300042599 | Bacteria | 4025 |
| 92 | Ga0466700_103647 | 3300042600 | Bacteria | 2957 |
| 93 | Ga0466707_137057 | 3300042601 | Bacteria | 3962 |
| 94 | Ga0466707_365246 | 3300042601 | Bacteria | 17576 |
| 95 | Ga0466714_032197 | 3300042603 | Bacteria | 2539 |
| 96 | Ga0466717_194874 | 3300042604 | Bacteria | 2500 |
| 97 | Ga0466722_120295 | 3300042609 | Bacteria | 3119 |
| 98 | Ga0466698_192753 | 3300042610 | Unclassified | 1233 |
| 99 | Ga0466697_213518 | 3300042611 | Bacteria | 1076 |
| 100 | Ga0466705_013387 | 3300042612 | Bacteria | 2709 |
| 101 | Ga0466735_094705 | 3300042624 | Bacteria | 5971 |
| 102 | Ga0466735_230018 | 3300042624 | Bacteria | 1542 |
| 103 | Ga0466708_016632 | 3300042652 | Bacteria | 33440 |
| 104 | Ga0466727_091459 | 3300042655 | Bacteria | 1291 |
| 105 | JGI24696J40584_12943920 | 3300002834 | Bacteria | 1792 |
| 106 | Ga0466711_238505 | 3300042615 | Bacteria | 3886 |
| 107 | Ga0466715_603434 | 3300042616 | Bacteria | 6616 |
| 108 | Ga0466715_604876 | 3300042616 | Bacteria | 36456 |
| 109 | Ga0466728_448938 | 3300042620 | Bacteria | 10195 |
| 110 | Ga0123356_10016492 | 3300010049 | Unclassified | 7045 |
| 111 | Ga0123353_10477379 | 3300010167 | Bacteria | 1826 |
| 112 | Ga0466714_132227 | 3300042603 | Bacteria | 4726 |
| 113 | Ga0466716_109841 | 3300042605 | Bacteria | 1438 |
| 114 | Ga0466716_513141 | 3300042605 | Bacteria | 17413 |
| 115 | Ga0466722_150225 | 3300042609 | Bacteria | 6922 |
| 116 | Ga0466705_127217 | 3300042612 | Bacteria | 28425 |
| 117 | IMNBL1DRAFT_c0003109 | 3300000062 | Bacteria | 10946 |
| 118 | Ga0123356_10308369 | 3300010049 | Bacteria | 1691 |
| 119 | Ga0466690_387937 | 3300042590 | Bacteria | 8988 |
| 120 | Ga0466696_346416 | 3300042596 | Bacteria | 19925 |
| 121 | Ga0466714_123371 | 3300042603 | Unclassified | 1725 |
| 122 | Ga0466722_078931 | 3300042609 | Bacteria | 1190 |
| 123 | Ga0466733_208763 | 3300042659 | Bacteria | 14257 |
| 124 | 2227069668 | 2225789003 | Bacteria | 14373 |
| 125 | IMNBL1DRAFT_c0000936 | 3300000062 | Bacteria | 22561 |
| 126 | JGI24705J35276_11950542 | 3300002504 | Bacteria | 794 |
| 127 | JGI24699J35502_11133621 | 3300002509 | Bacteria | 12648 |
| 128 | Ga0123357_10001046 | 3300009784 | Bacteria | 28431 |
| 129 | Ga0466715_015568 | 3300042616 | Bacteria | 4920 |
| 130 | Ga0123357_10106522 | 3300009784 | Bacteria | 3593 |
| 131 | Ga0466690_124913 | 3300042590 | Bacteria | 2042 |
| 132 | Ga0466691_092336 | 3300042593 | Bacteria | 8167 |
| 133 | Ga0466706_177539 | 3300042599 | Bacteria | 4392 |
| 134 | Ga0466700_040833 | 3300042600 | Bacteria | 26280 |
| 135 | Ga0466707_234638 | 3300042601 | Unclassified | 2101 |
| 136 | Ga0466719_312677 | 3300042606 | Bacteria | 2435 |
| 137 | Ga0466733_062768 | 3300042659 | Bacteria | 36272 |
| 138 | Ga0466733_157093 | 3300042659 | Bacteria | 3329 |
| 139 | Ga0466709_316667 | 3300042648 | Bacteria | 8932 |
| 140 | Ga0466727_090088 | 3300042655 | Bacteria | 55654 |
| 141 | JGI24705J35276_12186807 | 3300002504 | Bacteria | 1423 |
| 142 | Ga0466715_368047 | 3300042616 | Bacteria | 37322 |
| 143 | Ga0466728_468197 | 3300042620 | Bacteria | 2880 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03733 | YccF | Inner membrane component domain | 89 | 139 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.