Protein Family IF02120
Metagenome
Isolate
298
Members
165
Samples
211
Scaffolds
182.51
Avg Length
Representative Sequence
- ID
- 3300009463|Ga0127644_100036|Ga0127644_10003658
- Length
- 195 aa
- Sequence
- MGKQLKNSCNILEQLMTKLYSYYKTKIVKNLMTTLNYSSIMQVPRIDKIVLNMGVGSAASDKKTLENAILDLTAISGQKPIITKARKSVAGFKIRKGYPIGCKVTLRGKRKWDFLERLISIAIPRIRDFRGFSINSFDGQGNYSLGIREQIIFPEIDYDKIDRVRGLDVTIATTAKSNHEGHLLLSAFNFPFRK*
Sample Types
Isolate
29.2%
Metagenome
70.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
20.0%
Aphididae
18.6%
Unclassified
13.1%
Kalotermitidae
9.7%
Chrysomelidae
7.6%
Drosophilidae
5.5%
Tenebrionidae
3.4%
Blattidae
2.8%
Termopsidae
2.8%
Armadillidiidae
2.1%
Talitridae
2.1%
Palinuridae
1.4%
Passalidae
1.4%
Rhinotermitidae
1.4%
Lysianassidae
0.7%
Aphalaridae
0.7%
Hodotermitidae
0.7%
Ixodidae
0.7%
Hippoboscidae
0.7%
Hydrophilidae
0.7%
Culicidae
0.7%
Scarabaeidae
0.7%
Apidae
0.7%
Elmidae
0.7%
Dytiscidae
0.7%
Formicidae
0.7%
Taxonomy
Archaea
0
Bacteria
283
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 2 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 3 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 4 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 5 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 6 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 7 | 2654587723 | Buchnera aphidicola (Aphis glycines) BAg | Isolate | Aphididae |
| 8 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 9 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 12 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 13 | 650377915 | Buchnera aphidicola JF98 | Isolate | Aphididae |
| 14 | 650377916 | Buchnera aphidicola JF99 | Isolate | Aphididae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 23 | 3300009458 | Microbial communities of aphids from Asclepias tuberosa in Tucson, AZ, USA - Aphis nerii NM100509 seqcov | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 28 | 3002462131 | Borrelia sp. A-FGy1 | Isolate | Ixodidae |
| 29 | 2846861257 | Buchnera aphidicola LSU | Isolate | Aphididae |
| 30 | 2887836388 | Buchnera aphidicola BuCisplendens/3004 | Isolate | Aphididae |
| 31 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 32 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 33 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 36 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 39 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 40 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 2998827899 | Enterobacteriaceae endosymbiont of Donacia cincticornis DcincSym | Isolate | Chrysomelidae |
| 43 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 44 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 45 | 3300009477 | Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov | Metagenome | |
| 46 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 47 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 48 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 49 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 50 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 51 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 52 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 53 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 54 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 55 | 3300038942 | Host-associated microbial communities from haemolymph of Banana aphid from Africa - Madagascar | Metagenome | Aphididae |
| 56 | 2998828810 | Enterobacteriaceae endosymbiont of Donacia simplex DsimSym | Isolate | Chrysomelidae |
| 57 | 2998833461 | Enterobacteriaceae endosymbiont of Donacia marginata DmarSym | Isolate | Chrysomelidae |
| 58 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 59 | 3300009463 | Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov | Metagenome | |
| 60 | 3300009473 | Microbial communities of aphids from lettuce in Tucson, AZ, USA - Acyrthosiphon lactucae NM052899 seqcov | Metagenome | |
| 61 | 3300009479 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcov | Metagenome | Aphididae |
| 62 | 2884498641 | Buchnera aphidicola BuCicurvipes/3402 | Isolate | Aphididae |
| 63 | 2884500114 | Buchnera aphidicola BuCicuneomaculata/2628 | Isolate | Aphididae |
| 64 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 65 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 66 | 2820455747 | Unclassified Firmicutes Lab288P3bin160 | Isolate | Unclassified |
| 67 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 68 | 637000045 | Buchnera aphidicola Sg | Isolate | Aphididae |
| 69 | 643348522 | Buchnera aphidicola Tuc7 | Isolate | Aphididae |
| 70 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 71 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 72 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 73 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 74 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 75 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 76 | 2998829729 | Enterobacteriaceae endosymbiont of Donacia sparganii DsparSym | Isolate | Chrysomelidae |
| 77 | 2999134321 | Enterobacteriaceae endosymbiont of Donacia piscatrix DpisSym | Isolate | Chrysomelidae |
| 78 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 79 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 80 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 81 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 82 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 83 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 84 | 3300007088 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 4 gut | Metagenome | Drosophilidae |
| 85 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 86 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 87 | 2884499693 | Buchnera aphidicola BuCikochiana/2762 | Isolate | Aphididae |
| 88 | 2511231206 | Buchnera aphidicola Ak | Isolate | Aphididae |
| 89 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 90 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 91 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 92 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 93 | 2751185823 | Erwinia haradaeae 3056 | Isolate | Aphididae |
| 94 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 95 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 96 | 639633012 | Buchnera aphidicola Bp | Isolate | Aphididae |
| 97 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 98 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 99 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 100 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 101 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 102 | 2998828354 | Enterobacteriaceae endosymbiont of Donacia vulgaris DvulSym | Isolate | Chrysomelidae |
| 103 | 2999138033 | Enterobacteriaceae endosymbiont of Donacia provostii DprovSym | Isolate | Chrysomelidae |
| 104 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 105 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 106 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 107 | 2872745489 | Buchnera aphidicola LSR1 | Isolate | Aphididae |
| 108 | 2884497005 | Buchnera aphidicola BuCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 109 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 110 | 2843639003 | Buchnera aphidicola BuCistrobi/3249 | Isolate | Aphididae |
| 111 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 112 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 113 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 114 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 115 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 116 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 117 | 650377917 | Buchnera aphidicola LL01 | Isolate | Aphididae |
| 118 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 119 | 2998831604 | Enterobacteriaceae endosymbiont of Donacia thalassina DthaSym | Isolate | Chrysomelidae |
| 120 | 2999134809 | Enterobacteriaceae endosymbiont of Donacia crassipes DcraSym | Isolate | Chrysomelidae |
| 121 | 3300009471 | Microbial communities of aphids from galls on Rhus javanica in Mt Takao, Hachioji, Japan - Schlechtendalia chinensis CVD94-71 seqcov | Metagenome | |
| 122 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 123 | 2834887098 | Buchnera aphidicola LNK | Isolate | Aphididae |
| 124 | 2884492481 | Buchnera aphidicola BuCicurtihirsuta/3053 | Isolate | Aphididae |
| 125 | 2884492905 | Buchnera aphidicola BuCipiceae/3303 | Isolate | Aphididae |
| 126 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 127 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 128 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 129 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 130 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 131 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 132 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 133 | 643348520 | Buchnera aphidicola 5A | Isolate | Aphididae |
| 134 | 643348521 | Buchnera aphidicola Cc | Isolate | Aphididae |
| 135 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 136 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 137 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 138 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 139 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 140 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 141 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 142 | 3300009483 | Microbial communities of aphids from Rhus glabra galls in Chiricahua Mtns, AZ, USA - Melaphis rhois NM090294 seqcov | Metagenome | |
| 143 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 144 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 145 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 146 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 147 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 148 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 149 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 150 | 637000043 | Buchnera aphidicola APS | Isolate | Aphididae |
| 151 | 650377918 | Buchnera aphidicola TLW03 | Isolate | Aphididae |
| 152 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 153 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 154 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 155 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 156 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 157 | 2998832060 | Enterobacteriaceae endosymbiont of Donacia proxima DproxSym | Isolate | Chrysomelidae |
| 158 | 2998832509 | Enterobacteriaceae endosymbiont of Donacia cinerea DcinSym | Isolate | Chrysomelidae |
| 159 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 160 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 161 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 162 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 163 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 164 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 165 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_184966 | 3300042612 | Bacteria | 36484 |
| 2 | Ga0466705_186722 | 3300042612 | Bacteria | 5210 |
| 3 | Ga0466705_347533 | 3300042612 | Bacteria | 1948 |
| 4 | Ga0466733_063689 | 3300042659 | Unclassified | 2115 |
| 5 | Ga0466729_243888 | 3300042621 | Bacteria | 4126 |
| 6 | Ga0466735_017858 | 3300042624 | Bacteria | 100811 |
| 7 | Ga0466703_165743 | 3300042636 | Bacteria | 1943 |
| 8 | Ga0466715_038082 | 3300042616 | Bacteria | 19718 |
| 9 | Ga0466715_040556 | 3300042616 | Bacteria | 48791 |
| 10 | Ga0466715_416878 | 3300042616 | Bacteria | 48123 |
| 11 | Ga0466718_028304 | 3300042617 | Unclassified | 1509 |
| 12 | Ga0466723_026005 | 3300042618 | Bacteria | 7434 |
| 13 | Ga0466723_267328 | 3300042618 | Bacteria | 8390 |
| 14 | Ga0466728_402251 | 3300042620 | Bacteria | 1300 |
| 15 | Ga0123355_10002018 | 3300009826 | Bacteria | 28705 |
| 16 | Ga0123356_10011738 | 3300010049 | Bacteria | 8528 |
| 17 | Ga0123353_10000033 | 3300010167 | Bacteria | 150421 |
| 18 | Ga0123353_10007664 | 3300010167 | Bacteria | 14629 |
| 19 | Ga0123353_11190879 | 3300010167 | Bacteria | 1001 |
| 20 | Ga0123353_12152029 | 3300010167 | Bacteria | 677 |
| 21 | Ga0123354_10184268 | 3300010882 | Bacteria | 2368 |
| 22 | Ga0466714_025045 | 3300042603 | Bacteria | 5162 |
| 23 | Ga0466716_324999 | 3300042605 | Bacteria | 3338 |
| 24 | Ga0466719_203918 | 3300042606 | Bacteria | 15671 |
| 25 | Ga0068302_10005548 | 3300005071 | Bacteria | 4551 |
| 26 | Ga0105005_1009690 | 3300007505 | Bacteria | 3548 |
| 27 | Ga0415639_049987 | 3300038395 | Unclassified | 1540 |
| 28 | Ga0466693_147595 | 3300042592 | Bacteria | 1300 |
| 29 | Ga0466691_081749 | 3300042593 | Bacteria | 15757 |
| 30 | Ga0466696_137941 | 3300042596 | Bacteria | 25447 |
| 31 | Ga0466696_231535 | 3300042596 | Bacteria | 8719 |
| 32 | Ga0466704_084314 | 3300042643 | Bacteria | 2183 |
| 33 | Ga0466715_018839 | 3300042616 | Bacteria | 1878 |
| 34 | Ga0466715_157029 | 3300042616 | Bacteria | 16118 |
| 35 | Ga0466723_198786 | 3300042618 | Bacteria | 7899 |
| 36 | Ga0466729_159705 | 3300042621 | Bacteria | 9059 |
| 37 | Ga0123355_10672583 | 3300009826 | Bacteria | 1200 |
| 38 | Ga0123356_10828646 | 3300010049 | Bacteria | 1096 |
| 39 | Ga0123353_10023187 | 3300010167 | Bacteria | 9391 |
| 40 | Ga0123353_10850044 | 3300010167 | Bacteria | 1251 |
| 41 | Ga0123354_10059695 | 3300010882 | Bacteria | 5653 |
| 42 | Ga0466719_148243 | 3300042606 | Bacteria | 25348 |
| 43 | Ga0466719_528471 | 3300042606 | Bacteria | 3008 |
| 44 | Ga0466720_032600 | 3300042607 | Bacteria | 1037 |
| 45 | Ga0466698_211910 | 3300042610 | Unclassified | 2913 |
| 46 | JGI24705J35276_12156176 | 3300002504 | Bacteria | 1208 |
| 47 | Ga0072941_1103850 | 3300005201 | Bacteria | 1230 |
| 48 | Ga0127651_100078 | 3300009483 | Bacteria | 210306 |
| 49 | Ga0466690_269640 | 3300042590 | Unclassified | 2485 |
| 50 | Ga0466695_111301 | 3300042595 | Bacteria | 1039 |
| 51 | Ga0466699_256991 | 3300042597 | Bacteria | 17612 |
| 52 | Ga0466705_317371 | 3300042612 | Bacteria | 146251 |
| 53 | Ga0466727_349476 | 3300042655 | Bacteria | 8871 |
| 54 | Ga0466731_272351 | 3300042622 | Bacteria | 1214 |
| 55 | Ga0466703_071273 | 3300042636 | Bacteria | 5281 |
| 56 | Ga0466708_049385 | 3300042652 | Bacteria | 2537 |
| 57 | Ga0466710_330594 | 3300042613 | Bacteria | 1273 |
| 58 | Ga0466723_038419 | 3300042618 | Bacteria | 31685 |
| 59 | Ga0466723_258364 | 3300042618 | Bacteria | 7616 |
| 60 | Ga0466728_240671 | 3300042620 | Bacteria | 17710 |
| 61 | Ga0123356_10122111 | 3300010049 | Bacteria | 2536 |
| 62 | Ga0123356_10247704 | 3300010049 | Bacteria | 1857 |
| 63 | Ga0123356_11558019 | 3300010049 | Bacteria | 817 |
| 64 | Ga0123356_12065878 | 3300010049 | Unclassified | 711 |
| 65 | Ga0123353_10978784 | 3300010167 | Bacteria | 1140 |
| 66 | Ga0136159_1000005 | 3300010217 | Bacteria | 637387 |
| 67 | Ga0466716_465834 | 3300042605 | Bacteria | 1939 |
| 68 | IMNBL1DRAFT_c0000019 | 3300000062 | Bacteria | 170255 |
| 69 | JGI24698J34947_10046948 | 3300002449 | Unclassified | 2194 |
| 70 | JGI24695J34938_10010338 | 3300002450 | Bacteria | 5115 |
| 71 | JGI24702J35022_10016005 | 3300002462 | Bacteria | 4118 |
| 72 | JGI24702J35022_10274258 | 3300002462 | Bacteria | 988 |
| 73 | JGI24700J35501_10920524 | 3300002508 | Bacteria | 4578 |
| 74 | Ga0072941_1032250 | 3300005201 | Bacteria | 17989 |
| 75 | Ga0120204_000193 | 3300038942 | Bacteria | 2957 |
| 76 | Ga0466691_078633 | 3300042593 | Bacteria | 36589 |
| 77 | Ga0466705_519658 | 3300042612 | Bacteria | 15800 |
| 78 | Ga0466715_069772 | 3300042616 | Bacteria | 32177 |
| 79 | Ga0466715_257161 | 3300042616 | Bacteria | 85931 |
| 80 | Ga0466715_393770 | 3300042616 | Bacteria | 24865 |
| 81 | Ga0466718_046336 | 3300042617 | Bacteria | 63413 |
| 82 | Ga0466723_192342 | 3300042618 | Bacteria | 20312 |
| 83 | Ga0466726_071199 | 3300042619 | Bacteria | 1661 |
| 84 | Ga0466728_037007 | 3300042620 | Bacteria | 2749 |
| 85 | Ga0123355_11343899 | 3300009826 | Bacteria | 712 |
| 86 | Ga0123353_10000836 | 3300010167 | Bacteria | 37407 |
| 87 | Ga0123353_11345323 | 3300010167 | Bacteria | 923 |
| 88 | Ga0466700_278997 | 3300042600 | Bacteria | 3447 |
| 89 | Ga0466720_163331 | 3300042607 | Bacteria | 1967 |
| 90 | HBC_ctgsDRAFT_1012618 | 3300000333 | Bacteria | 2027 |
| 91 | HBC_ctgsDRAFT_1085445 | 3300000333 | Unclassified | 743 |
| 92 | Ga0068302_10021184 | 3300005071 | Bacteria | 4651 |
| 93 | Ga0068305_10201228 | 3300005083 | Bacteria | 1347 |
| 94 | Ga0127653_100120 | 3300009471 | Bacteria | 188812 |
| 95 | Ga0466690_091622 | 3300042590 | Bacteria | 5894 |
| 96 | Ga0466705_238064 | 3300042612 | Bacteria | 17407 |
| 97 | Ga0466705_261073 | 3300042612 | Bacteria | 35670 |
| 98 | Ga0466733_074730 | 3300042659 | Bacteria | 1642 |
| 99 | Ga0562375_0011 | 3300056856 | Bacteria | 1302371 |
| 100 | Ga0466729_307483 | 3300042621 | Bacteria | 4040 |
| 101 | Ga0466703_245771 | 3300042636 | Bacteria | 1634 |
| 102 | Ga0466703_416828 | 3300042636 | Bacteria | 4413 |
| 103 | Ga0466704_241474 | 3300042643 | Bacteria | 23689 |
| 104 | Ga0466724_36559 | 3300042649 | Unclassified | 17690 |
| 105 | Ga0466728_051305 | 3300042620 | Bacteria | 1474 |
| 106 | Ga0123355_10000459 | 3300009826 | Bacteria | 53637 |
| 107 | Ga0123355_11289411 | 3300009826 | Bacteria | 734 |
| 108 | Ga0123353_10319220 | 3300010167 | Bacteria | 2358 |
| 109 | Ga0123353_11019427 | 3300010167 | Bacteria | 1110 |
| 110 | Ga0466706_187631 | 3300042599 | Bacteria | 1331 |
| 111 | Ga0466719_239926 | 3300042606 | Bacteria | 3087 |
| 112 | 2227553789 | 2225789004 | Bacteria | 2816 |
| 113 | JGI24702J35022_10000742 | 3300002462 | Bacteria | 20088 |
| 114 | Ga0127656_114077 | 3300009453 | Bacteria | 4891 |
| 115 | Ga0415639_033820 | 3300038395 | Bacteria | 8317 |
| 116 | Ga0466657_142036 | 3300042582 | Bacteria | 2616 |
| 117 | Ga0466691_191273 | 3300042593 | Bacteria | 20272 |
| 118 | Ga0466696_232378 | 3300042596 | Bacteria | 6933 |
| 119 | Ga0466696_491940 | 3300042596 | Bacteria | 4756 |
| 120 | Ga0466734_158812 | 3300042623 | Bacteria | 13514 |
| 121 | Ga0466704_013130 | 3300042643 | Bacteria | 1334 |
| 122 | Ga0466704_040120 | 3300042643 | Bacteria | 6863 |
| 123 | Ga0466709_218885 | 3300042648 | Bacteria | 3409 |
| 124 | Ga0466709_317685 | 3300042648 | Bacteria | 1011 |
| 125 | Ga0466708_082549 | 3300042652 | Bacteria | 53797 |
| 126 | Ga0466715_054461 | 3300042616 | Bacteria | 7688 |
| 127 | Ga0466715_358041 | 3300042616 | Bacteria | 25582 |
| 128 | Ga0466723_173631 | 3300042618 | Bacteria | 36631 |
| 129 | Ga0466723_218975 | 3300042618 | Bacteria | 3845 |
| 130 | Ga0123355_10043402 | 3300009826 | Bacteria | 7314 |
| 131 | Ga0123355_10045492 | 3300009826 | Bacteria | 7139 |
| 132 | Ga0123355_10062967 | 3300009826 | Bacteria | 5985 |
| 133 | Ga0123355_10194254 | 3300009826 | Bacteria | 2980 |
| 134 | Ga0123355_10200921 | 3300009826 | Bacteria | 2912 |
| 135 | Ga0123355_10348278 | 3300009826 | Bacteria | 1965 |
| 136 | Ga0123355_10377037 | 3300009826 | Bacteria | 1852 |
| 137 | Ga0123356_10951220 | 3300010049 | Unclassified | 1030 |
| 138 | Ga0123356_11179448 | 3300010049 | Bacteria | 932 |
| 139 | Ga0123353_10005887 | 3300010167 | Bacteria | 16213 |
| 140 | Ga0123353_10116112 | 3300010167 | Bacteria | 4307 |
| 141 | Ga0123353_10149725 | 3300010167 | Bacteria | 3727 |
| 142 | Ga0123353_10214582 | 3300010167 | Bacteria | 3015 |
| 143 | Ga0123353_10321937 | 3300010167 | Bacteria | 2346 |
| 144 | Ga0123353_10940488 | 3300010167 | Bacteria | 1171 |
| 145 | Ga0123353_11620302 | 3300010167 | Bacteria | 816 |
| 146 | Ga0466707_081410 | 3300042601 | Bacteria | 24723 |
| 147 | Ga0466707_152407 | 3300042601 | Bacteria | 36983 |
| 148 | Ga0466716_187068 | 3300042605 | Bacteria | 1375 |
| 149 | Ga0466719_465481 | 3300042606 | Bacteria | 1043 |
| 150 | Ga0466722_193513 | 3300042609 | Bacteria | 5276 |
| 151 | JGI24702J35022_10017033 | 3300002462 | Bacteria | 3977 |
| 152 | JGI24702J35022_10448454 | 3300002462 | Bacteria | 785 |
| 153 | Ga0072940_1074405 | 3300005200 | Bacteria | 5479 |
| 154 | Ga0127649_111176 | 3300009460 | Bacteria | 11019 |
| 155 | Ga0127645_100025 | 3300009461 | Bacteria | 631301 |
| 156 | Ga0160469_100001 | 3300012824 | Bacteria | 1115787 |
| 157 | Ga0415639_118069 | 3300038395 | Unclassified | 2554 |
| 158 | Ga0466695_394164 | 3300042595 | Unclassified | 1726 |
| 159 | Ga0466705_245982 | 3300042612 | Bacteria | 20685 |
| 160 | Ga0466705_274927 | 3300042612 | Bacteria | 2031 |
| 161 | Ga0466733_050686 | 3300042659 | Bacteria | 13440 |
| 162 | Ga0530661_000258 | 3300056564 | Bacteria | 42354 |
| 163 | Ga0466710_017395 | 3300042613 | Bacteria | 26782 |
| 164 | Ga0466711_245098 | 3300042615 | Bacteria | 3715 |
| 165 | Ga0466715_154133 | 3300042616 | Bacteria | 37484 |
| 166 | Ga0466723_101181 | 3300042618 | Bacteria | 14736 |
| 167 | Ga0123356_10247758 | 3300010049 | Bacteria | 1857 |
| 168 | Ga0123353_10076129 | 3300010167 | Bacteria | 5392 |
| 169 | Ga0160464_100196 | 3300012805 | Bacteria | 61467 |
| 170 | Ga0466714_121442 | 3300042603 | Bacteria | 1630 |
| 171 | Ga0466716_060708 | 3300042605 | Bacteria | 3862 |
| 172 | JGI24700J35501_10924065 | 3300002508 | Bacteria | 5357 |
| 173 | Ga0127646_100058 | 3300009458 | Bacteria | 571963 |
| 174 | Ga0127520_1000008 | 3300009473 | Bacteria | 642906 |
| 175 | Ga0127522_100011 | 3300009477 | Bacteria | 644448 |
| 176 | Ga0160467_100669 | 3300012829 | Unclassified | 26397 |
| 177 | Ga0415639_096673 | 3300038395 | Bacteria | 2010 |
| 178 | Ga0466693_113441 | 3300042592 | Bacteria | 28543 |
| 179 | Ga0466691_044532 | 3300042593 | Bacteria | 1524 |
| 180 | Ga0466705_285307 | 3300042612 | Bacteria | 25130 |
| 181 | Ga0466705_325997 | 3300042612 | Bacteria | 31796 |
| 182 | Ga0466732_004379 | 3300042656 | Bacteria | 9663 |
| 183 | Ga0466733_006814 | 3300042659 | Bacteria | 4937 |
| 184 | Ga0466735_049114 | 3300042624 | Bacteria | 5314 |
| 185 | Ga0466704_282928 | 3300042643 | Bacteria | 16421 |
| 186 | Ga0466704_435478 | 3300042643 | Bacteria | 4889 |
| 187 | Ga0466725_214850 | 3300042654 | Bacteria | 4242 |
| 188 | Ga0466711_062730 | 3300042615 | Bacteria | 2421 |
| 189 | Ga0466711_322571 | 3300042615 | Bacteria | 3767 |
| 190 | Ga0466723_019869 | 3300042618 | Bacteria | 35706 |
| 191 | Ga0466723_084643 | 3300042618 | Bacteria | 11167 |
| 192 | Ga0466723_306212 | 3300042618 | Bacteria | 6356 |
| 193 | Ga0466728_081199 | 3300042620 | Bacteria | 3795 |
| 194 | Ga0466728_251755 | 3300042620 | Bacteria | 48527 |
| 195 | Ga0123355_10027091 | 3300009826 | Bacteria | 9253 |
| 196 | Ga0123355_10122057 | 3300009826 | Unclassified | 4038 |
| 197 | Ga0123355_10144143 | 3300009826 | Bacteria | 3636 |
| 198 | Ga0123353_10003075 | 3300010167 | Bacteria | 20893 |
| 199 | Ga0123353_10655775 | 3300010167 | Bacteria | 1484 |
| 200 | Ga0466716_083499 | 3300042605 | Bacteria | 2853 |
| 201 | 2227591299 | 2225789004 | Bacteria | 12952 |
| 202 | Ga0068305_10393470 | 3300005083 | Bacteria | 2729 |
| 203 | Ga0104047_1122724 | 3300007088 | Bacteria | 1031 |
| 204 | Ga0105553_1041511 | 3300007767 | Bacteria | 37664 |
| 205 | Ga0127657_100003 | 3300009457 | Bacteria | 550482 |
| 206 | Ga0127644_100036 | 3300009463 | Bacteria | 636219 |
| 207 | Ga0127529_1000015 | 3300009479 | Bacteria | 636679 |
| 208 | Ga0160433_101554 | 3300012846 | Unclassified | 6101 |
| 209 | Ga0264413_125592 | 3300024493 | Bacteria | 15616 |
| 210 | Ga0316159_10117 | 3300030930 | Bacteria | 13568 |
| 211 | Ga0466690_010408 | 3300042590 | Bacteria | 1026 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.