Protein Family IF01614
Metagenome
Isolate
282
Members
226
Samples
111
Scaffolds
378.97
Avg Length
Representative Sequence
- ID
- 3300007067|Ga0103266_1000136|Ga0103266_10001367
- Length
- 407 aa
- Sequence
- MGQACILPACFFRPFFRLLFIVKIIIAPDSFKESLSAADAAQAIAAGVAAACPQAQVHCIPMADGGEGTVAAVLAAVQEKGEWRYTDVHGALDAVSSGAGLRAGWGWLAGQSGDATAVIEMAAAAGLEQTPPASRDPLRASSVGVGELILAALDAGARRIILGLGGSSCNDGGAGMLCALGLRLLDAQGRDLPPGGAALARLARIDASGLDARLRDVAIDIASDVDNPLTGPNGATTIFGPQKGATPAQLVELDAALAHYGALSTQYLGRDFRDAPGAGAAGGLGYAAHAWLGARFRPGVEVVAELGGLADAMAGAALAFTGEGRLDAQTLRGKTPAGVARIAKDAGVPLVALAGSLGDGYEALYEHGLTAAFSLAGGPMDLAQAKRDAAQLLTARARDVTRVWLV*
Sample Types
Isolate
60.6%
Metagenome
39.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
23.4%
Elmidae
8.6%
Muscidae
5.7%
Curculionidae
5.7%
Termitidae
5.7%
Apidae
5.3%
Anthocoridae
4.8%
Drosophilidae
4.3%
Blattidae
3.8%
Formicidae
3.8%
Culicidae
3.8%
Armadillidiidae
3.3%
Tenebrionidae
3.3%
Kalotermitidae
2.4%
Scarabaeidae
1.9%
Talitridae
1.4%
Cerambycidae
1.4%
Calliphoridae
1.4%
Passalidae
1.0%
Pteromalidae
1.0%
Palinuridae
1.0%
Thripidae
0.5%
Anthomyiidae
0.5%
Stratiomyidae
0.5%
Artemiidae
0.5%
Nephropidae
0.5%
Ceratophyllidae
0.5%
Trigoniulidae
0.5%
Pentatomidae
0.5%
Daphniidae
0.5%
Hodotermitidae
0.5%
Rhopalidae
0.5%
Penaeidae
0.5%
Crambidae
0.5%
Siricidae
0.5%
Taxonomy
Archaea
0
Bacteria
258
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 2 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 3 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 4 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 5 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 6 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 7 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 8 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 9 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 10 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 11 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 12 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 13 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 14 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 15 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 16 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 17 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 18 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 19 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 20 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 21 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 22 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 25 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 26 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 27 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 28 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 29 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 30 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 31 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 32 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 33 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 34 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 35 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 36 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 37 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 38 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 39 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 40 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 41 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 42 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 43 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 44 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 45 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 46 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 47 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 48 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 49 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 50 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 51 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 52 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 53 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 54 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 55 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 56 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 57 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 58 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 59 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 60 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 61 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 62 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 63 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 64 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 65 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 66 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 67 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 68 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 69 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 70 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 71 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 72 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 73 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 74 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 75 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 76 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 77 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 78 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 79 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 80 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 81 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 82 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 83 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 84 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 85 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 86 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 87 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 88 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 89 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 90 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 91 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 92 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 93 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 94 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 95 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 96 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 97 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 98 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 99 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 100 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 101 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 102 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 103 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 104 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 105 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 106 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 107 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 108 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 109 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 110 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 111 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 112 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 113 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 114 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 115 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 116 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 117 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 118 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 119 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 120 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 121 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 122 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 123 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 124 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 125 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 126 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 127 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 128 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 129 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 130 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 131 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 132 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 133 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 134 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 135 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 136 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 137 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 138 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 139 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 140 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 141 | 2861449170 | Desulfovibrio intestinalis DSM 11275 | Isolate | Unclassified |
| 142 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 143 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 144 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 145 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 146 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 147 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 148 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 149 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 150 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 151 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 152 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 153 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 154 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 155 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 156 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 157 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 158 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 159 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 160 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 161 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 162 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 163 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 164 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 165 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 166 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 167 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 168 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 169 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 170 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 171 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 172 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 173 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 174 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 175 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 176 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 177 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 178 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 179 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 180 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 181 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 182 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 183 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 184 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 185 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 186 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 187 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 188 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 189 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 190 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 191 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 192 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 193 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 194 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 195 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 196 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 197 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 198 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 199 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 200 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 201 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 202 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 203 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 204 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 205 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 206 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 207 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 208 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 209 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 210 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 211 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 212 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 213 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 214 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 215 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 216 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 217 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 218 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 219 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 220 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 221 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 222 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 223 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 224 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 225 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 226 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 2 | Ga0562379_0069 | 3300056790 | Bacteria | 430601 |
| 3 | Ga0562377_0805 | 3300056842 | Unclassified | 42338 |
| 4 | Ga0466701_096728 | 3300042598 | Bacteria | 2787 |
| 5 | Ga0466713_088144 | 3300042602 | Bacteria | 17171 |
| 6 | FGTW_contig30424 | 2065487013 | Bacteria | 46135 |
| 7 | JGI24699J35502_11130535 | 3300002509 | Bacteria | 5163 |
| 8 | Ga0160453_100123 | 3300012814 | Bacteria | 78292 |
| 9 | Ga0160468_100173 | 3300012819 | Bacteria | 47688 |
| 10 | Ga0160433_100031 | 3300012846 | Bacteria | 172603 |
| 11 | Ga0264413_101850 | 3300024493 | Bacteria | 4337 |
| 12 | Ga0562378_2030 | 3300056814 | Bacteria | 18727 |
| 13 | Ga0562376_1102 | 3300056857 | Unclassified | 40277 |
| 14 | Ga0562374_0064 | 3300057007 | Bacteria | 350233 |
| 15 | Ga0466713_131912 | 3300042602 | Bacteria | 29597 |
| 16 | DPO_contig00990 | 2032320009 | Bacteria | 46760 |
| 17 | SPBB_contig11516 | 2044078006 | Bacteria | 90532 |
| 18 | IMNBL1DRAFT_c0000006 | 3300000062 | Bacteria | 247403 |
| 19 | CVPL010W_10020354 | 3300002931 | Bacteria | 7573 |
| 20 | CVPL005W_1000721 | 3300002934 | Bacteria | 11612 |
| 21 | Ga0063521_1000845 | 3300003973 | Unclassified | 10523 |
| 22 | Ga0102739_1002921 | 3300007095 | Bacteria | 2565 |
| 23 | Ga0103264_1000069 | 3300007188 | Bacteria | 85289 |
| 24 | Ga0466724_04616 | 3300042649 | Unclassified | 2865 |
| 25 | Ga0466724_24119 | 3300042649 | Bacteria | 301338 |
| 26 | Ga0160441_100083 | 3300012825 | Bacteria | 114325 |
| 27 | Ga0160431_103321 | 3300012828 | Bacteria | 3364 |
| 28 | Ga0466701_008162 | 3300042598 | Bacteria | 138467 |
| 29 | Ga0466733_141870 | 3300042659 | Bacteria | 11427 |
| 30 | Ga0530661_001183 | 3300056564 | Bacteria | 14316 |
| 31 | Ga0562379_0926 | 3300056790 | Unclassified | 42655 |
| 32 | Ga0562379_1241 | 3300056790 | Unclassified | 31318 |
| 33 | Ga0562375_1128 | 3300056856 | Unclassified | 40147 |
| 34 | Ga0466701_055280 | 3300042598 | Bacteria | 22188 |
| 35 | Meta3P_1001423 | 3300002464 | Unclassified | 1956 |
| 36 | Ga0103266_1000136 | 3300007067 | Bacteria | 23718 |
| 37 | Ga0466724_05229 | 3300042649 | Bacteria | 33843 |
| 38 | Ga0466723_348583 | 3300042618 | Unclassified | 6409 |
| 39 | Ga0160453_100105 | 3300012814 | Bacteria | 85609 |
| 40 | Ga0160467_100062 | 3300012829 | Bacteria | 159890 |
| 41 | Ga0160472_100305 | 3300012839 | Bacteria | 50196 |
| 42 | Ga0160454_100112 | 3300012798 | Bacteria | 100261 |
| 43 | Ga0466705_188833 | 3300042612 | Unclassified | 6467 |
| 44 | Ga0530661_000008 | 3300056564 | Bacteria | 327436 |
| 45 | Ga0562378_2573 | 3300056814 | Unclassified | 14453 |
| 46 | Ga0562377_0165 | 3300056842 | Unclassified | 182346 |
| 47 | Ga0562377_0533 | 3300056842 | Bacteria | 59704 |
| 48 | Ga0562377_0936 | 3300056842 | Bacteria | 37241 |
| 49 | DPOL_contig12797 | 2035918003 | Unclassified | 6911 |
| 50 | Meta3P_1000236 | 3300002464 | Bacteria | 24894 |
| 51 | Ga0466730_001886 | 3300042625 | Bacteria | 7861 |
| 52 | Ga0466703_425653 | 3300042636 | Bacteria | 82792 |
| 53 | Ga0466709_411005 | 3300042648 | Bacteria | 41852 |
| 54 | Ga0466724_64498 | 3300042649 | Bacteria | 13151 |
| 55 | Ga0160447_101201 | 3300012849 | Bacteria | 10340 |
| 56 | Ga0466693_387689 | 3300042592 | Bacteria | 7228 |
| 57 | Ga0466733_120067 | 3300042659 | Bacteria | 152095 |
| 58 | Ga0562376_0180 | 3300056857 | Unclassified | 132306 |
| 59 | Ga0466713_075796 | 3300042602 | Bacteria | 58807 |
| 60 | DPO_contig00670 | 2032320009 | Bacteria | 28519 |
| 61 | Ga0102735_1000145 | 3300007080 | Bacteria | 21702 |
| 62 | Ga0104045_1011981 | 3300007085 | Bacteria | 2856 |
| 63 | Ga0104019_1031678 | 3300007150 | Unclassified | 1875 |
| 64 | Ga0466730_007633 | 3300042625 | Bacteria | 2096 |
| 65 | Ga0466704_509831 | 3300042643 | Bacteria | 133092 |
| 66 | Ga0466724_40074 | 3300042649 | Bacteria | 90242 |
| 67 | Ga0466725_248881 | 3300042654 | Bacteria | 5542 |
| 68 | Ga0160452_104428 | 3300012834 | Bacteria | 2204 |
| 69 | Ga0160455_100078 | 3300012837 | Bacteria | 160114 |
| 70 | Ga0123356_10172378 | 3300010049 | Bacteria | 2176 |
| 71 | Ga0466733_142985 | 3300042659 | Bacteria | 32755 |
| 72 | Ga0562378_1863 | 3300056814 | Unclassified | 20499 |
| 73 | Ga0562377_0119 | 3300056842 | Unclassified | 245367 |
| 74 | Ga0562377_0219 | 3300056842 | Bacteria | 141429 |
| 75 | Ga0466701_072699 | 3300042598 | Bacteria | 11513 |
| 76 | Ga0466706_067447 | 3300042599 | Bacteria | 5564 |
| 77 | SPBB_contig10681 | 2044078006 | Bacteria | 147815 |
| 78 | SWWA_contig04381__length_21682___numreads_1035 | 2100351016 | Bacteria | 21682 |
| 79 | IMNBL1DRAFT_c0000607 | 3300000062 | Bacteria | 28740 |
| 80 | CVPL010W_10000175 | 3300002931 | Bacteria | 55645 |
| 81 | CVPL010L_1000495 | 3300002932 | Bacteria | 12053 |
| 82 | Ga0103264_1000010 | 3300007188 | Bacteria | 126108 |
| 83 | Ga0466724_18477 | 3300042649 | Bacteria | 32570 |
| 84 | Ga0466724_50079 | 3300042649 | Bacteria | 18697 |
| 85 | Ga0160467_102946 | 3300012829 | Bacteria | 3223 |
| 86 | Ga0160444_104986 | 3300012841 | Unclassified | 1783 |
| 87 | Ga0160433_101743 | 3300012846 | Unclassified | 5498 |
| 88 | Ga0160442_100001 | 3300012806 | Bacteria | 1594759 |
| 89 | Ga0562379_0100 | 3300056790 | Bacteria | 294662 |
| 90 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 91 | Ga0562377_0014 | 3300056842 | Bacteria | 1212095 |
| 92 | Ga0562376_5143 | 3300056857 | Bacteria | 9229 |
| 93 | Ga0562374_0274 | 3300057007 | Bacteria | 100745 |
| 94 | Ga0466713_001678 | 3300042602 | Bacteria | 81551 |
| 95 | DPOL_contig00322 | 2035918003 | Bacteria | 72223 |
| 96 | Ga0466730_032447 | 3300042625 | Bacteria | 115525 |
| 97 | Ga0466723_300495 | 3300042618 | Bacteria | 14323 |
| 98 | Ga0160469_100104 | 3300012824 | Bacteria | 130054 |
| 99 | Ga0160469_100284 | 3300012824 | Bacteria | 35180 |
| 100 | Ga0160441_100068 | 3300012825 | Bacteria | 134559 |
| 101 | Ga0160472_100085 | 3300012839 | Bacteria | 150451 |
| 102 | Ga0530661_002106 | 3300056564 | Unclassified | 8124 |
| 103 | Ga0562377_0194 | 3300056842 | Unclassified | 159163 |
| 104 | Ga0562375_0025 | 3300056856 | Bacteria | 749171 |
| 105 | Ga0562376_0043 | 3300056857 | Unclassified | 318471 |
| 106 | SWWA_contig03468__length_3826___numreads_76 | 2100351016 | Unclassified | 3826 |
| 107 | 2227065799 | 2225789003 | Bacteria | 3349 |
| 108 | Ga0123357_10000346 | 3300009784 | Bacteria | 43712 |
| 109 | Ga0466724_05350 | 3300042649 | Bacteria | 16299 |
| 110 | Ga0160457_1000585 | 3300012858 | Bacteria | 14797 |
| 111 | Ga0160464_100270 | 3300012805 | Unclassified | 47707 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02595 | Gly_kinase | Glycerate kinase family | 24 | 404 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.