Protein Family IF01610
Metagenome
Isolate
156
Members
88
Samples
123
Scaffolds
257.21
Avg Length
Representative Sequence
- ID
- 3300007067|Ga0103266_1000043|Ga0103266_100004351
- Length
- 287 aa
- Sequence
- MRNHCAQSVALLNVFMLRSALHSWRQALLPMSDIILETSHLTKEFKGFTAVSDVHLAVRRGTIHALIGPNGAGKTTCFNLLTKFLEPTSGSIRFNGIDITREQPAQIARRGVIRSFQISAVFPHLTLLENVRLGLQRKLGTSYHFWRSARSLQQLDARAMELLGEVGLQALAHEVTVNLPYGRKRALEIATTLAMEPELMLLDEPTQGMGHEDVDRVTQLIQKVSQGRTILMVEHNMKVISSIADRITVLQRGAVLAEGAYEEVSNNPQVMEAYMGTTDGQLQGAH*
Sample Types
Isolate
21.1%
Metagenome
78.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
21.0%
Formicidae
19.8%
Unclassified
13.6%
Culicidae
12.3%
Elmidae
9.9%
Armadillidiidae
7.4%
Coreidae
4.9%
Curculionidae
4.9%
Hydrophilidae
2.5%
Drosophilidae
1.2%
Crambidae
1.2%
Alydidae
1.2%
Taxonomy
Archaea
0
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
33
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 2 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 3 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 4 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 5 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 6 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 7 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 8 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 9 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 10 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 11 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 12 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 13 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 14 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 15 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 16 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 17 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 18 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 19 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 20 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 21 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 24 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 25 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 26 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 27 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 28 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 29 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 30 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 31 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 32 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 33 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 34 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 35 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 36 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 39 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 40 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 41 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 42 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 43 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 44 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 45 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 46 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 47 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 48 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 49 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 50 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 51 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 52 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 53 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 54 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 55 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 56 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 57 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 58 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 59 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 60 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 61 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 62 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 63 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 64 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 65 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 66 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 67 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 68 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 69 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 70 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 71 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 72 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 73 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 74 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 75 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 76 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 77 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 78 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 79 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 80 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 81 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 82 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 83 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 84 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 85 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 86 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 87 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 88 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10199919 | 3300009826 | Unclassified | 2923 |
| 2 | Ga0160442_101070 | 3300012806 | Bacteria | 3602 |
| 3 | Ga0466701_048722 | 3300042598 | Bacteria | 6630 |
| 4 | Ga0160467_100823 | 3300012829 | Bacteria | 20487 |
| 5 | Ga0160447_112878 | 3300012849 | Unclassified | 1676 |
| 6 | Ga0466693_320673 | 3300042592 | Bacteria | 2552 |
| 7 | Ga0466734_124192 | 3300042623 | Bacteria | 1860 |
| 8 | Ga0466730_051824 | 3300042625 | Bacteria | 124707 |
| 9 | JGI24705J35276_12233369 | 3300002504 | Unclassified | 4809 |
| 10 | CVPL005L_10026545 | 3300002938 | Bacteria | 2275 |
| 11 | Ga0102735_1000003 | 3300007080 | Bacteria | 119358 |
| 12 | Ga0103264_1000020 | 3300007188 | Bacteria | 106161 |
| 13 | Ga0466710_154507 | 3300042613 | Bacteria | 9150 |
| 14 | Ga0123357_10277294 | 3300009784 | Unclassified | 1739 |
| 15 | Ga0123356_10005833 | 3300010049 | Bacteria | 12502 |
| 16 | Ga0123356_10061839 | 3300010049 | Bacteria | 3497 |
| 17 | Ga0466717_000940 | 3300042604 | Unclassified | 1414 |
| 18 | Ga0466721_170989 | 3300042608 | Bacteria | 1922 |
| 19 | Ga0160458_100788 | 3300012832 | Bacteria | 9429 |
| 20 | Ga0160452_102579 | 3300012834 | Unclassified | 3721 |
| 21 | Ga0160472_103072 | 3300012839 | Bacteria | 3461 |
| 22 | Ga0466734_171113 | 3300042623 | Bacteria | 8424 |
| 23 | Ga0466730_060188 | 3300042625 | Bacteria | 807184 |
| 24 | Ga0466730_098566 | 3300042625 | Bacteria | 4233 |
| 25 | Ga0102739_1000443 | 3300007095 | Unclassified | 8518 |
| 26 | Ga0103260_1004537 | 3300007139 | Bacteria | 2113 |
| 27 | Ga0103264_1000106 | 3300007188 | Bacteria | 48559 |
| 28 | Ga0123356_10112056 | 3300010049 | Bacteria | 2637 |
| 29 | Ga0160466_100065 | 3300012809 | Bacteria | 124006 |
| 30 | Ga0160470_100092 | 3300012813 | Bacteria | 109818 |
| 31 | Ga0160440_101850 | 3300012815 | Unclassified | 2434 |
| 32 | Ga0160459_108465 | 3300012831 | Bacteria | 1266 |
| 33 | Ga0160446_101467 | 3300012835 | Unclassified | 5059 |
| 34 | Ga0160472_104427 | 3300012839 | Unclassified | 2468 |
| 35 | Ga0160445_114515 | 3300012847 | Bacteria | 1102 |
| 36 | Ga0160435_1006123 | 3300012857 | Bacteria | 2682 |
| 37 | Ga0160436_1003860 | 3300012861 | Unclassified | 3625 |
| 38 | Ga0466699_360712 | 3300042597 | Bacteria | 1291 |
| 39 | Ga0466731_015451 | 3300042622 | Bacteria | 8644 |
| 40 | Ga0466724_30683 | 3300042649 | Bacteria | 28177 |
| 41 | Ga0102734_1000848 | 3300007129 | Bacteria | 9963 |
| 42 | Ga0105005_1115357 | 3300007505 | Unclassified | 6017 |
| 43 | Ga0123355_10101500 | 3300009826 | Bacteria | 4528 |
| 44 | Ga0123356_10031100 | 3300010049 | Unclassified | 4996 |
| 45 | Ga0123356_10082388 | 3300010049 | Bacteria | 3046 |
| 46 | Ga0123356_10134455 | 3300010049 | Unclassified | 2428 |
| 47 | Ga0123356_10233035 | 3300010049 | Bacteria | 1907 |
| 48 | Ga0123354_10183808 | 3300010882 | Bacteria | 2373 |
| 49 | Ga0160431_100022 | 3300012828 | Bacteria | 159471 |
| 50 | Ga0160455_100048 | 3300012837 | Bacteria | 254011 |
| 51 | Ga0160435_1005970 | 3300012857 | Unclassified | 2721 |
| 52 | Ga0466657_222087 | 3300042582 | Bacteria | 1101 |
| 53 | Ga0466734_152324 | 3300042623 | Bacteria | 1924 |
| 54 | Ga0466734_164039 | 3300042623 | Bacteria | 2753 |
| 55 | JGI24705J35276_12238643 | 3300002504 | Bacteria | 31594 |
| 56 | CVPL005W_1000110 | 3300002934 | Bacteria | 47533 |
| 57 | Ga0102734_1000237 | 3300007129 | Bacteria | 17063 |
| 58 | Ga0102737_1000467 | 3300007142 | Bacteria | 13285 |
| 59 | Ga0103264_1000174 | 3300007188 | Bacteria | 37788 |
| 60 | Ga0123356_10145566 | 3300010049 | Unclassified | 2344 |
| 61 | Ga0123356_10257216 | 3300010049 | Bacteria | 1827 |
| 62 | Ga0160466_102949 | 3300012809 | Bacteria | 3025 |
| 63 | Ga0160453_105605 | 3300012814 | Bacteria | 2002 |
| 64 | Ga0160443_101020 | 3300012848 | Bacteria | 12136 |
| 65 | Ga0160430_100708 | 3300012852 | Bacteria | 16217 |
| 66 | Ga0160457_1010415 | 3300012858 | Bacteria | 1322 |
| 67 | Ga0466657_001575 | 3300042582 | Bacteria | 2950 |
| 68 | Ga0466724_42462 | 3300042649 | Bacteria | 351483 |
| 69 | Ga0466725_082207 | 3300042654 | Bacteria | 4161 |
| 70 | Ga0466725_255245 | 3300042654 | Bacteria | 1628 |
| 71 | CVPL005W_1000322 | 3300002934 | Unclassified | 20759 |
| 72 | CVPL005L_10000084 | 3300002938 | Bacteria | 65089 |
| 73 | Ga0103266_1000043 | 3300007067 | Bacteria | 57382 |
| 74 | Ga0102737_1000404 | 3300007142 | Unclassified | 14515 |
| 75 | Ga0123355_10013996 | 3300009826 | Bacteria | 12512 |
| 76 | Ga0123355_10315754 | 3300009826 | Unclassified | 2112 |
| 77 | Ga0123356_10517816 | 3300010049 | Unclassified | 1351 |
| 78 | Ga0123354_10008043 | 3300010882 | Bacteria | 15995 |
| 79 | Ga0466717_181971 | 3300042604 | Bacteria | 5214 |
| 80 | Ga0160459_100379 | 3300012831 | Unclassified | 19017 |
| 81 | Ga0160472_100446 | 3300012839 | Bacteria | 29864 |
| 82 | Ga0160434_108321 | 3300012850 | Bacteria | 1708 |
| 83 | Ga0160435_1005373 | 3300012857 | Unclassified | 2906 |
| 84 | Ga0466731_010768 | 3300042622 | Bacteria | 13580 |
| 85 | Ga0466734_138860 | 3300042623 | Bacteria | 5426 |
| 86 | Ga0466725_082240 | 3300042654 | Unclassified | 3021 |
| 87 | CVPL010W_10006534 | 3300002931 | Bacteria | 11894 |
| 88 | CVPL005W_1000941 | 3300002934 | Unclassified | 15640 |
| 89 | Ga0063521_1000420 | 3300003973 | Bacteria | 22607 |
| 90 | Ga0102737_1000375 | 3300007142 | Bacteria | 15116 |
| 91 | Ga0102737_1000860 | 3300007142 | Unclassified | 9336 |
| 92 | Ga0103264_1000740 | 3300007188 | Bacteria | 27982 |
| 93 | Ga0103268_1000047 | 3300007192 | Bacteria | 37076 |
| 94 | Ga0105005_1003639 | 3300007505 | Unclassified | 5730 |
| 95 | Ga0105005_1009652 | 3300007505 | Bacteria | 5593 |
| 96 | Ga0123356_10346128 | 3300010049 | Bacteria | 1609 |
| 97 | Ga0160471_100453 | 3300012812 | Bacteria | 11639 |
| 98 | Ga0466701_099271 | 3300042598 | Bacteria | 5447 |
| 99 | Ga0466717_118702 | 3300042604 | Unclassified | 2807 |
| 100 | Ga0466693_038474 | 3300042592 | Bacteria | 10839 |
| 101 | Ga0466725_267725 | 3300042654 | Bacteria | 10995 |
| 102 | Ga0466725_286119 | 3300042654 | Bacteria | 1360 |
| 103 | CVPL010W_10009606 | 3300002931 | Bacteria | 8710 |
| 104 | Ga0102740_1005896 | 3300007140 | Unclassified | 2241 |
| 105 | Ga0102740_1006821 | 3300007140 | Bacteria | 2005 |
| 106 | Ga0105005_1018391 | 3300007505 | Unclassified | 6010 |
| 107 | Ga0105005_1123069 | 3300007505 | Unclassified | 5861 |
| 108 | Ga0123357_10004201 | 3300009784 | Unclassified | 16804 |
| 109 | Ga0123357_10094843 | 3300009784 | Bacteria | 3871 |
| 110 | Ga0123355_10055851 | 3300009826 | Bacteria | 6393 |
| 111 | Ga0123355_10580870 | 3300009826 | Bacteria | 1340 |
| 112 | Ga0123356_10408533 | 3300010049 | Bacteria | 1497 |
| 113 | Ga0160440_100082 | 3300012815 | Bacteria | 114002 |
| 114 | Ga0160469_100024 | 3300012824 | Bacteria | 306500 |
| 115 | Ga0160472_102514 | 3300012839 | Bacteria | 4092 |
| 116 | Ga0466657_001658 | 3300042582 | Bacteria | 1577 |
| 117 | Ga0466724_38973 | 3300042649 | Bacteria | 164403 |
| 118 | CVPL010W_10004536 | 3300002931 | Bacteria | 20486 |
| 119 | Ga0063521_1000454 | 3300003973 | Bacteria | 20418 |
| 120 | Ga0102736_1003632 | 3300007052 | Unclassified | 2200 |
| 121 | Ga0103261_1001282 | 3300007083 | Bacteria | 4007 |
| 122 | Ga0102738_1004451 | 3300007141 | Unclassified | 1997 |
| 123 | Ga0103267_1000019 | 3300007190 | Bacteria | 80290 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300007505 | Ga0105005_1123069 | Ga0105005_11230698 | 237 |
| 2 | 3300007505 | Ga0105005_1115357 | Ga0105005_11153577 | 239 |
| 3 | 3300012848 | Ga0160443_101020 | Ga0160443_1010206 | 240 |
| 4 | 3300007505 | Ga0105005_1018391 | Ga0105005_10183917 | 243 |
| 5 | iso_pr_bacteria | 2873571580 | 2873572098 | 246 |
| 6 | 3300003973 | Ga0063521_1000454 | Ga0063521_10004546 | 250 |
| 7 | 3300010049 | Ga0123356_10408533 | Ga0123356_104085332 | 250 |
| 8 | 3300042604 | Ga0466717_118702 | Ga0466717_118702_1453_2205 | 250 |
| 9 | 3300009784 | Ga0123357_10277294 | Ga0123357_102772942 | 251 |
| 10 | 3300009826 | Ga0123355_10101500 | Ga0123355_101015002 | 251 |
| 11 | 3300010049 | Ga0123356_10031100 | Ga0123356_100311002 | 251 |
| 12 | 3300010049 | Ga0123356_10134455 | Ga0123356_101344552 | 251 |
| 13 | 3300010049 | Ga0123356_10346128 | Ga0123356_103461282 | 251 |
| 14 | 3300010049 | Ga0123356_10517816 | Ga0123356_105178161 | 251 |
| 15 | 3300042604 | Ga0466717_000940 | Ga0466717_000940_185_940 | 251 |
| 16 | iso_pr_bacteria | 2582581321 | 2585352665 | 251 |
| 17 | iso_pr_bacteria | 2681813507 | 2684383287 | 251 |
| 18 | iso_pr_bacteria | 2820115951 | 2820119567 | 251 |
| 19 | iso_pr_bacteria | 2833478085 | 2833478179 | 251 |
| 20 | iso_pr_bacteria | 2855798354 | 2855799416 | 251 |
| 21 | 3300002504 | JGI24705J35276_12238643 | JGI24705J35276_1223864314 | 252 |
| 22 | 3300009784 | Ga0123357_10004201 | Ga0123357_1000420110 | 252 |
| 23 | 3300009826 | Ga0123355_10580870 | Ga0123355_105808702 | 252 |
| 24 | 3300010882 | Ga0123354_10183808 | Ga0123354_101838082 | 252 |
| 25 | 3300012831 | Ga0160459_100379 | Ga0160459_1003796 | 252 |
| 26 | 3300012857 | Ga0160435_1005970 | Ga0160435_10059703 | 252 |
| 27 | 3300012858 | Ga0160457_1010415 | Ga0160457_10104153 | 252 |
| 28 | iso_pr_bacteria | 2724678956 | 2724786758 | 252 |
| 29 | 3300003973 | Ga0063521_1000420 | Ga0063521_10004204 | 253 |
| 30 | 3300009826 | Ga0123355_10013996 | Ga0123355_100139965 | 253 |
| 31 | 3300009826 | Ga0123355_10315754 | Ga0123355_103157542 | 253 |
| 32 | 3300010049 | Ga0123356_10233035 | Ga0123356_102330352 | 253 |
| 33 | 3300012806 | Ga0160442_101070 | Ga0160442_1010702 | 253 |
| 34 | 3300012852 | Ga0160430_100708 | Ga0160430_10070814 | 253 |
| 35 | 3300042623 | Ga0466734_152324 | Ga0466734_152324_490_1251 | 253 |
| 36 | 3300042654 | Ga0466725_267725 | Ga0466725_267725_8309_9070 | 253 |
| 37 | 3300009826 | Ga0123355_10055851 | Ga0123355_100558516 | 254 |
| 38 | 3300009826 | Ga0123355_10199919 | Ga0123355_101999192 | 254 |
| 39 | 3300010049 | Ga0123356_10257216 | Ga0123356_102572161 | 254 |
| 40 | 3300012847 | Ga0160445_114515 | Ga0160445_1145151 | 254 |
| 41 | 3300007505 | Ga0105005_1003639 | Ga0105005_10036397 | 255 |
| 42 | 3300007190 | Ga0103267_1000019 | Ga0103267_100001952 | 256 |
| 43 | 3300012839 | Ga0160472_103072 | Ga0160472_1030723 | 256 |
| 44 | 3300042598 | Ga0466701_048722 | Ga0466701_048722_2739_3509 | 256 |
| 45 | 3300042625 | Ga0466730_060188 | Ga0466730_060188_57570_58340 | 256 |
| 46 | 3300042625 | Ga0466730_098566 | Ga0466730_098566_3277_4047 | 256 |
| 47 | 3300042649 | Ga0466724_30683 | Ga0466724_30683_21888_22658 | 256 |
| 48 | iso_pr_bacteria | 2518285616 | 2518644020 | 256 |
| 49 | iso_pr_bacteria | 2864826666 | 2864828026 | 256 |
| 50 | iso_pr_bacteria | 2864870719 | 2864871662 | 256 |
| 51 | iso_pr_bacteria | 2864937364 | 2864940433 | 256 |
| 52 | iso_pr_bacteria | 2864960361 | 2864961307 | 256 |
| 53 | iso_pr_bacteria | 2864968865 | 2864970903 | 256 |
| 54 | iso_pr_bacteria | 2868169047 | 2868169259 | 256 |
| 55 | iso_pr_bacteria | 2873571580 | 2873575296 | 256 |
| 56 | iso_pr_bacteria | 8024031916 | 8024036557 | 256 |
| 57 | iso_pr_bacteria | 8025708040 | 8025711457 | 256 |
| 58 | iso_pr_bacteria | 8078130113 | 8078133213 | 256 |
| 59 | iso_pr_bacteria | 8100449422 | 8100454145 | 256 |
| 60 | iso_pr_bacteria | 8100455565 | 8100459774 | 256 |
| 61 | iso_pr_bacteria | 8100461708 | 8100463143 | 256 |
| 62 | iso_pr_bacteria | 8102094248 | 8102101420 | 256 |
| 63 | iso_pr_bacteria | 8102193924 | 8102197339 | 256 |
| 64 | 3300002931 | CVPL010W_10004536 | CVPL010W_1000453612 | 257 |
| 65 | 3300002931 | CVPL010W_10006534 | CVPL010W_100065346 | 257 |
| 66 | 3300002934 | CVPL005W_1000941 | CVPL005W_100094111 | 257 |
| 67 | 3300007080 | Ga0102735_1000003 | Ga0102735_1000003115 | 257 |
| 68 | 3300007095 | Ga0102739_1000443 | Ga0102739_10004433 | 257 |
| 69 | 3300007129 | Ga0102734_1000237 | Ga0102734_10002373 | 257 |
| 70 | 3300007129 | Ga0102734_1000848 | Ga0102734_100084811 | 257 |
| 71 | 3300007139 | Ga0103260_1004537 | Ga0103260_10045372 | 257 |
| 72 | 3300007141 | Ga0102738_1004451 | Ga0102738_10044513 | 257 |
| 73 | 3300007142 | Ga0102737_1000860 | Ga0102737_10008602 | 257 |
| 74 | 3300012813 | Ga0160470_100092 | Ga0160470_10009284 | 257 |
| 75 | 3300012814 | Ga0160453_105605 | Ga0160453_1056052 | 257 |
| 76 | 3300012815 | Ga0160440_101850 | Ga0160440_1018502 | 257 |
| 77 | 3300012824 | Ga0160469_100024 | Ga0160469_100024173 | 257 |
| 78 | 3300012828 | Ga0160431_100022 | Ga0160431_100022114 | 257 |
| 79 | 3300012831 | Ga0160459_108465 | Ga0160459_1084652 | 257 |
| 80 | 3300012832 | Ga0160458_100788 | Ga0160458_1007884 | 257 |
| 81 | 3300012834 | Ga0160452_102579 | Ga0160452_1025792 | 257 |
| 82 | 3300012839 | Ga0160472_104427 | Ga0160472_1044272 | 257 |
| 83 | 3300012861 | Ga0160436_1003860 | Ga0160436_10038602 | 257 |
| 84 | 3300042582 | Ga0466657_001658 | Ga0466657_001658_496_1269 | 257 |
| 85 | 3300042582 | Ga0466657_222087 | Ga0466657_222087_217_990 | 257 |
| 86 | 3300042592 | Ga0466693_320673 | Ga0466693_320673_1338_2111 | 257 |
| 87 | 3300042598 | Ga0466701_099271 | Ga0466701_099271_1756_2529 | 257 |
| 88 | 3300042604 | Ga0466717_181971 | Ga0466717_181971_2689_3462 | 257 |
| 89 | 3300042608 | Ga0466721_170989 | Ga0466721_170989_1127_1900 | 257 |
| 90 | 3300042613 | Ga0466710_154507 | Ga0466710_154507_837_1610 | 257 |
| 91 | 3300042622 | Ga0466731_010768 | Ga0466731_010768_1487_2260 | 257 |
| 92 | 3300042623 | Ga0466734_171113 | Ga0466734_171113_2996_3769 | 257 |
| 93 | 3300042649 | Ga0466724_42462 | Ga0466724_42462_251940_252713 | 257 |
| 94 | 3300042654 | Ga0466725_082207 | Ga0466725_082207_3312_4085 | 257 |
| 95 | 3300042654 | Ga0466725_255245 | Ga0466725_255245_790_1563 | 257 |
| 96 | 3300042654 | Ga0466725_286119 | Ga0466725_286119_276_1049 | 257 |
| 97 | iso_pr_bacteria | 2603880170 | 2606030330 | 257 |
| 98 | iso_pr_bacteria | 2687453742 | 2689987399 | 257 |
| 99 | iso_pr_bacteria | 2687453753 | 2690039654 | 257 |
| 100 | iso_pr_bacteria | 2820059968 | 2820060489 | 257 |
| 101 | iso_pr_bacteria | 2855798354 | 2855802606 | 257 |
| 102 | iso_pr_bacteria | 8024031916 | 8024035052 | 257 |
| 103 | 3300002504 | JGI24705J35276_12233369 | JGI24705J35276_122333692 | 258 |
| 104 | 3300002934 | CVPL005W_1000110 | CVPL005W_10001108 | 258 |
| 105 | 3300002934 | CVPL005W_1000322 | CVPL005W_100032218 | 258 |
| 106 | 3300002938 | CVPL005L_10000084 | CVPL005L_1000008432 | 258 |
| 107 | 3300002938 | CVPL005L_10026545 | CVPL005L_100265453 | 258 |
| 108 | 3300007052 | Ga0102736_1003632 | Ga0102736_10036323 | 258 |
| 109 | 3300007142 | Ga0102737_1000375 | Ga0102737_10003754 | 258 |
| 110 | 3300007142 | Ga0102737_1000404 | Ga0102737_100040414 | 258 |
| 111 | 3300007188 | Ga0103264_1000020 | Ga0103264_100002044 | 258 |
| 112 | 3300007188 | Ga0103264_1000106 | Ga0103264_100010621 | 258 |
| 113 | 3300007188 | Ga0103264_1000174 | Ga0103264_10001748 | 258 |
| 114 | 3300007188 | Ga0103264_1000740 | Ga0103264_10007403 | 258 |
| 115 | 3300009784 | Ga0123357_10094843 | Ga0123357_100948432 | 258 |
| 116 | 3300010882 | Ga0123354_10008043 | Ga0123354_1000804312 | 258 |
| 117 | 3300012809 | Ga0160466_100065 | Ga0160466_10006524 | 258 |
| 118 | 3300012809 | Ga0160466_102949 | Ga0160466_1029492 | 258 |
| 119 | 3300012812 | Ga0160471_100453 | Ga0160471_1004538 | 258 |
| 120 | 3300012835 | Ga0160446_101467 | Ga0160446_1014674 | 258 |
| 121 | 3300012839 | Ga0160472_102514 | Ga0160472_1025142 | 258 |
| 122 | 3300012849 | Ga0160447_112878 | Ga0160447_1128782 | 258 |
| 123 | 3300012857 | Ga0160435_1005373 | Ga0160435_10053732 | 258 |
| 124 | 3300012857 | Ga0160435_1006123 | Ga0160435_10061233 | 258 |
| 125 | 3300042582 | Ga0466657_001575 | Ga0466657_001575_1996_2772 | 258 |
| 126 | 3300042623 | Ga0466734_124192 | Ga0466734_124192_598_1374 | 258 |
| 127 | 3300042654 | Ga0466725_082240 | Ga0466725_082240_1828_2604 | 258 |
| 128 | iso_pr_bacteria | 2524614573 | 2524998837 | 258 |
| 129 | 3300007083 | Ga0103261_1001282 | Ga0103261_10012825 | 259 |
| 130 | 3300007140 | Ga0102740_1005896 | Ga0102740_10058964 | 259 |
| 131 | 3300007142 | Ga0102737_1000467 | Ga0102737_10004679 | 259 |
| 132 | 3300012815 | Ga0160440_100082 | Ga0160440_100082115 | 259 |
| 133 | 3300012839 | Ga0160472_100446 | Ga0160472_10044610 | 259 |
| 134 | 3300042623 | Ga0466734_138860 | Ga0466734_138860_4253_5032 | 259 |
| 135 | 3300002931 | CVPL010W_10009606 | CVPL010W_100096062 | 260 |
| 136 | 3300007140 | Ga0102740_1006821 | Ga0102740_10068212 | 260 |
| 137 | 3300042623 | Ga0466734_164039 | Ga0466734_164039_1811_2596 | 261 |
| 138 | 3300012829 | Ga0160467_100823 | Ga0160467_10082314 | 262 |
| 139 | iso_pr_bacteria | 2864808494 | 2864810501 | 262 |
| 140 | iso_pr_bacteria | 2864812326 | 2864814569 | 262 |
| 141 | 3300007505 | Ga0105005_1009652 | Ga0105005_10096527 | 264 |
| 142 | 3300010049 | Ga0123356_10112056 | Ga0123356_101120563 | 265 |
| 143 | 3300010049 | Ga0123356_10005833 | Ga0123356_100058338 | 266 |
| 144 | 3300010049 | Ga0123356_10082388 | Ga0123356_100823883 | 266 |
| 145 | 3300010049 | Ga0123356_10145566 | Ga0123356_101455662 | 266 |
| 146 | 3300042592 | Ga0466693_038474 | Ga0466693_038474_6323_7126 | 267 |
| 147 | 3300042597 | Ga0466699_360712 | Ga0466699_360712_373_1176 | 267 |
| 148 | 3300042649 | Ga0466724_38973 | Ga0466724_38973_46831_47634 | 267 |
| 149 | 3300010049 | Ga0123356_10061839 | Ga0123356_100618394 | 268 |
| 150 | iso_pr_bacteria | 2873565274 | 2873568532 | 271 |
| 151 | 3300012837 | Ga0160455_100048 | Ga0160455_100048188 | 275 |
| 152 | 3300042622 | Ga0466731_015451 | Ga0466731_015451_4651_5493 | 280 |
| 153 | 3300042625 | Ga0466730_051824 | Ga0466730_051824_111068_111913 | 281 |
| 154 | 3300012850 | Ga0160434_108321 | Ga0160434_1083212 | 285 |
| 155 | 3300007067 | Ga0103266_1000043 | Ga0103266_100004351 | 287 |
| 156 | 3300007192 | Ga0103268_1000047 | Ga0103268_100004718 | 287 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.87 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.