Protein Family IF01225
Metagenome
Metatranscriptome
Isolate
344
Members
238
Samples
173
Scaffolds
374.26
Avg Length
Representative Sequence
- ID
- 3300005200|Ga0072940_1004697|Ga0072940_10046971
- Length
- 453 aa
- Sequence
- MASLSLRGIYKRYPGGVVAVSDFTMNIKDKEFIILVGPSGCGKSTTLRMIAGLEEISEGELFIGDRLVNDVAPKDRDIAMVFQNYALYPHMSVFENMAFGLKLRKVPKDQIKKLVDEAAKILDITHLLDRKPKALSGGQRQRVALGRAIVRDPQVFLLDEPLSNLDAKLRAQMRTELAKLHKKLGTTFIYVTHDQIEAMTMGDRIVVMKDGYIQQIDSPINLYSNPVNKFVAGFMGSPQMNFIDAKLIMLNNKYTLEFGSEDSKTTRGRKFYIEIPPAKADTEALRYYLDKDVILGIRPENIHDSEMFLSNAKTGIIEATVDVTEMMGAETYLYLSCEGTPLTVRVSSRSVARPQDVIKLAIDPXXXXRRNRNDGRGNLSVPVLRGYAADSPRFVPLRRETAGRYQARDRPGVYPPFRRERRTLDISVINTGNRRIKRPLRVSRIGLFNKKA*
Sample Types
Isolate
49.7%
Metagenome
50.0%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
34.5%
Unclassified
21.6%
Termitidae
9.5%
Culicidae
5.2%
Blattidae
4.3%
Kalotermitidae
4.3%
Curculionidae
3.9%
Elmidae
3.9%
Armadillidiidae
1.7%
Tenebrionidae
1.7%
Termopsidae
1.3%
Formicidae
1.3%
Rhinotermitidae
0.9%
Largidae
0.9%
Passalidae
0.9%
Apidae
0.9%
Berytidae
0.9%
Ceratopogonidae
0.4%
Alydidae
0.4%
Noctuidae
0.4%
Siricidae
0.4%
Hodotermitidae
0.4%
Stratiomyidae
0.4%
Taxonomy
Archaea
0
Bacteria
319
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 2 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 3 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 4 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 5 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 6 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 7 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 8 | 2914375287 | Culicoidibacter larvae CS-1 | Isolate | Ceratopogonidae |
| 9 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 10 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 11 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 12 | 2964144231 | Entomospira culicis BR151 | Isolate | Culicidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 15 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 16 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 17 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 18 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 19 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 20 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 21 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 22 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 23 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 24 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 25 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 26 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 27 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 28 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 29 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 30 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 31 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 34 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 35 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 36 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 37 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 38 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 39 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 40 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 46 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 47 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 48 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 49 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 50 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 51 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 52 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 53 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 54 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 55 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 56 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 57 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 58 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 59 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 60 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 61 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 62 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 63 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 64 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 65 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 66 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 67 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 68 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 69 | 2820296961 | Unclassified Firmicutes Th196P3bin102 | Isolate | Unclassified |
| 70 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 71 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 72 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 73 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 74 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 75 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 76 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 77 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 78 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 79 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 80 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 81 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 82 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 83 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 84 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 85 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 86 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 87 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 88 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 89 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 90 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 91 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 92 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 93 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 94 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 95 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 96 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 97 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 98 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 99 | 8063597228 | Entomospira culicis BR151 | Isolate | Culicidae |
| 100 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 101 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 102 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 103 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 104 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 105 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 106 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 107 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 108 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 109 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 110 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 111 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 112 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 113 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 114 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 115 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 116 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 117 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 118 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 119 | 2820401926 | Unclassified Firmicutes Mp193P1bin2 | Isolate | Unclassified |
| 120 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 121 | 2820528380 | Unclassified Firmicutes Lab288P1bin143 | Isolate | Unclassified |
| 122 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 123 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 124 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 125 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 126 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 127 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 128 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 129 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 130 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 131 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 132 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 133 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 134 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 135 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 136 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 137 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 138 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 139 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 140 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 141 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 142 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 143 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 144 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 145 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 146 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 147 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 148 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 149 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 150 | 2964145936 | Entomospira culicis BR149 | Isolate | Culicidae |
| 151 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 152 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 153 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 154 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 155 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 156 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 157 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 158 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 159 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 160 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 161 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 162 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 163 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 164 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 165 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 166 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 167 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 168 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 169 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 170 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 171 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 172 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 173 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 174 | 2820403592 | Unclassified Firmicutes Lab288P4bin93 | Isolate | Unclassified |
| 175 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 176 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 177 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 178 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 179 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 180 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 181 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 182 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 183 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 184 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 185 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 186 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 187 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 188 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 189 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 190 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 191 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 192 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 193 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 194 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 195 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 196 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 197 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 198 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 199 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 200 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 201 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 202 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 203 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 204 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 205 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 206 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 207 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 208 | 2820569216 | Unclassified Firmicutes Emb289P3bin33 | Isolate | Unclassified |
| 209 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 210 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 211 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 212 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 213 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 214 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 215 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 216 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 217 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 218 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 219 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 220 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 221 | 8063595521 | Entomospira culicis BR149 | Isolate | Culicidae |
| 222 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 223 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 224 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 225 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 226 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 227 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 228 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 229 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 230 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 231 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 232 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 233 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 234 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 235 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 236 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 237 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 238 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562375_1315 | 3300056856 | Bacteria | 34813 |
| 2 | Ga0466701_061643 | 3300042598 | Bacteria | 58895 |
| 3 | Ga0466706_085592 | 3300042599 | Unclassified | 13613 |
| 4 | Ga0466706_100751 | 3300042599 | Bacteria | 6295 |
| 5 | Ga0466706_117767 | 3300042599 | Unclassified | 18838 |
| 6 | Ga0466706_161558 | 3300042599 | Bacteria | 23538 |
| 7 | Ga0466714_147045 | 3300042603 | Bacteria | 6014 |
| 8 | Ga0466721_100978 | 3300042608 | Bacteria | 228571 |
| 9 | Ga0466697_022999 | 3300042611 | Bacteria | 13757 |
| 10 | DPO_contig08735 | 2032320009 | Bacteria | 73498 |
| 11 | SPBB_contig11591 | 2044078006 | Bacteria | 22857 |
| 12 | SWWA_contig31718__length_12923___numreads_678 | 2100351016 | Bacteria | 12923 |
| 13 | 2227502118 | 2225789004 | Bacteria | 3779 |
| 14 | AustNasuHG_c1000039 | 3300000089 | Bacteria | 32381 |
| 15 | Ga0068302_10015921 | 3300005071 | Bacteria | 6347 |
| 16 | Ga0072940_1004697 | 3300005200 | Bacteria | 10333 |
| 17 | Ga0160453_101431 | 3300012814 | Bacteria | 8274 |
| 18 | Ga0123356_10007335 | 3300010049 | Bacteria | 11004 |
| 19 | Ga0123353_10228889 | 3300010167 | Bacteria | 2900 |
| 20 | Ga0466723_111262 | 3300042618 | Unclassified | 1206 |
| 21 | Ga0466733_214729 | 3300042659 | Bacteria | 2196 |
| 22 | Ga0466706_052707 | 3300042599 | Unclassified | 9358 |
| 23 | Ga0466706_087602 | 3300042599 | Unclassified | 8353 |
| 24 | Ga0466700_449218 | 3300042600 | Bacteria | 1481 |
| 25 | Ga0466707_385701 | 3300042601 | Bacteria | 2601 |
| 26 | Ga0466714_159261 | 3300042603 | Bacteria | 2014 |
| 27 | Ga0466716_168734 | 3300042605 | Bacteria | 1572 |
| 28 | Ga0466721_395057 | 3300042608 | Bacteria | 1427 |
| 29 | Ga0466722_268467 | 3300042609 | Bacteria | 11403 |
| 30 | SWWA_contig07510__length_2908___numreads_51 | 2100351016 | Bacteria | 2908 |
| 31 | JGI24703J35330_11748046 | 3300002501 | Bacteria | 10151 |
| 32 | Ga0160433_100037 | 3300012846 | Bacteria | 158548 |
| 33 | Ga0123355_10005261 | 3300009826 | Bacteria | 18895 |
| 34 | Ga0160465_101177 | 3300012803 | Unclassified | 8195 |
| 35 | Ga0466705_437505 | 3300042612 | Bacteria | 2812 |
| 36 | Ga0466715_014633 | 3300042616 | Bacteria | 8144 |
| 37 | Ga0466730_005411 | 3300042625 | Bacteria | 2170 |
| 38 | Ga0466702_310410 | 3300042635 | Bacteria | 57730 |
| 39 | Ga0466724_31109 | 3300042649 | Bacteria | 49504 |
| 40 | Ga0466727_262987 | 3300042655 | Bacteria | 2206 |
| 41 | Ga0562379_0003 | 3300056790 | Bacteria | 3011780 |
| 42 | Ga0466701_032157 | 3300042598 | Bacteria | 6258 |
| 43 | Ga0466707_314791 | 3300042601 | Bacteria | 1904 |
| 44 | DPOL_contig15748 | 2035918003 | Unclassified | 10086 |
| 45 | IMNBL1DRAFT_c0026635 | 3300000062 | Bacteria | 2192 |
| 46 | JGI24697J35500_11272113 | 3300002507 | Bacteria | 4798 |
| 47 | Ga0123355_10003518 | 3300009826 | Bacteria | 22478 |
| 48 | Ga0123355_10247323 | 3300009826 | Bacteria | 2517 |
| 49 | Ga0123355_10286456 | 3300009826 | Bacteria | 2267 |
| 50 | Ga0160464_101371 | 3300012805 | Bacteria | 8750 |
| 51 | Ga0466711_039073 | 3300042615 | Bacteria | 8618 |
| 52 | Ga0466711_282119 | 3300042615 | Bacteria | 18149 |
| 53 | Ga0466735_129136 | 3300042624 | Bacteria | 4840 |
| 54 | Ga0466702_085745 | 3300042635 | Bacteria | 153497 |
| 55 | Ga0466704_448849 | 3300042643 | Bacteria | 8452 |
| 56 | Ga0466705_128064 | 3300042612 | Bacteria | 302359 |
| 57 | Ga0562374_0902 | 3300057007 | Bacteria | 41188 |
| 58 | Ga0466706_141554 | 3300042599 | Unclassified | 9670 |
| 59 | Ga0466706_260369 | 3300042599 | Unclassified | 11122 |
| 60 | Ga0466722_173116 | 3300042609 | Bacteria | 181242 |
| 61 | Ga0102734_1001375 | 3300007129 | Bacteria | 13945 |
| 62 | Ga0160459_101708 | 3300012831 | Bacteria | 4286 |
| 63 | Ga0160447_101000 | 3300012849 | Unclassified | 11674 |
| 64 | Ga0160448_101849 | 3300012854 | Bacteria | 6734 |
| 65 | Ga0123356_10049873 | 3300010049 | Bacteria | 3896 |
| 66 | Ga0123356_10174914 | 3300010049 | Unclassified | 2162 |
| 67 | Ga0123353_10009815 | 3300010167 | Bacteria | 13263 |
| 68 | Ga0123353_10321680 | 3300010167 | Bacteria | 2347 |
| 69 | Ga0466729_270647 | 3300042621 | Bacteria | 4127 |
| 70 | Ga0466702_381445 | 3300042635 | Unclassified | 3811 |
| 71 | Ga0466704_165905 | 3300042643 | Unclassified | 2276 |
| 72 | Ga0562378_2658 | 3300056814 | Unclassified | 13840 |
| 73 | Ga0466701_044241 | 3300042598 | Bacteria | 190116 |
| 74 | Ga0466701_091404 | 3300042598 | Bacteria | 73007 |
| 75 | Ga0466706_134222 | 3300042599 | Bacteria | 5399 |
| 76 | Ga0466706_173479 | 3300042599 | Bacteria | 49734 |
| 77 | Ga0466706_251547 | 3300042599 | Bacteria | 84388 |
| 78 | Ga0466714_040389 | 3300042603 | Bacteria | 3795 |
| 79 | Ga0466719_208594 | 3300042606 | Bacteria | 13260 |
| 80 | IMNBL1DRAFT_c0000030 | 3300000062 | Bacteria | 129938 |
| 81 | IMNBL1DRAFT_c0026878 | 3300000062 | Bacteria | 2177 |
| 82 | JGI24695J34938_10001145 | 3300002450 | Bacteria | 23702 |
| 83 | JGI24695J34938_10023535 | 3300002450 | Unclassified | 2968 |
| 84 | JGI24703J35330_11677799 | 3300002501 | Bacteria | 1783 |
| 85 | JGI24703J35330_11735581 | 3300002501 | Bacteria | 2979 |
| 86 | CVPL010W_10005043 | 3300002931 | Bacteria | 14333 |
| 87 | CVPL010L_1001083 | 3300002932 | Bacteria | 12930 |
| 88 | Ga0160470_100169 | 3300012813 | Bacteria | 58987 |
| 89 | Ga0160472_100357 | 3300012839 | Bacteria | 41006 |
| 90 | Ga0160444_100570 | 3300012841 | Bacteria | 14099 |
| 91 | Ga0160435_1000932 | 3300012857 | Bacteria | 7881 |
| 92 | Ga0160457_1008418 | 3300012858 | Bacteria | 1487 |
| 93 | Ga0123356_10000006 | 3300010049 | Bacteria | 247371 |
| 94 | Ga0123356_10269780 | 3300010049 | Unclassified | 1791 |
| 95 | Ga0123353_10000166 | 3300010167 | Bacteria | 83177 |
| 96 | Ga0123353_10357841 | 3300010167 | Bacteria | 2195 |
| 97 | Ga0123354_10025103 | 3300010882 | Bacteria | 9399 |
| 98 | Ga0160471_101084 | 3300012812 | Unclassified | 5835 |
| 99 | Ga0466703_410236 | 3300042636 | Bacteria | 2803 |
| 100 | Ga0466724_20392 | 3300042649 | Bacteria | 43032 |
| 101 | Ga0466724_33487 | 3300042649 | Bacteria | 79889 |
| 102 | Ga0562379_0016 | 3300056790 | Bacteria | 1192610 |
| 103 | Ga0466706_138829 | 3300042599 | Bacteria | 2705 |
| 104 | Ga0466706_274406 | 3300042599 | Unclassified | 1930 |
| 105 | Ga0466700_494716 | 3300042600 | Bacteria | 2899 |
| 106 | Ga0466707_356416 | 3300042601 | Bacteria | 23192 |
| 107 | Ga0466714_102972 | 3300042603 | Bacteria | 11382 |
| 108 | Ga0466714_120213 | 3300042603 | Bacteria | 3352 |
| 109 | Ga0466721_060278 | 3300042608 | Bacteria | 1237 |
| 110 | DPOL_contig01759 | 2035918003 | Bacteria | 10659 |
| 111 | 2227607953 | 2225789004 | Unclassified | 12200 |
| 112 | Ga0123357_10000707 | 3300009784 | Bacteria | 33513 |
| 113 | Ga0415639_000895 | 3300038395 | Bacteria | 89488 |
| 114 | Ga0123353_10017927 | 3300010167 | Bacteria | 10439 |
| 115 | Ga0123353_10153812 | 3300010167 | Bacteria | 3670 |
| 116 | Ga0466715_403879 | 3300042616 | Bacteria | 11580 |
| 117 | Ga0466733_173067 | 3300042659 | Bacteria | 7514 |
| 118 | Ga0562379_0268 | 3300056790 | Bacteria | 136199 |
| 119 | Ga0562378_2877 | 3300056814 | Unclassified | 12355 |
| 120 | Ga0466706_002831 | 3300042599 | Bacteria | 37676 |
| 121 | Ga0466706_031583 | 3300042599 | Bacteria | 20995 |
| 122 | Ga0466706_032665 | 3300042599 | Unclassified | 5579 |
| 123 | Ga0466706_071220 | 3300042599 | Bacteria | 12544 |
| 124 | Ga0466706_166937 | 3300042599 | Bacteria | 29473 |
| 125 | Ga0466706_232304 | 3300042599 | Unclassified | 13436 |
| 126 | Ga0466707_350404 | 3300042601 | Bacteria | 15405 |
| 127 | Ga0466714_064562 | 3300042603 | Bacteria | 45553 |
| 128 | FGTW_contig30925 | 2065487013 | Unclassified | 7608 |
| 129 | 2227105807 | 2225789004 | Bacteria | 9493 |
| 130 | Ga0068305_10148152 | 3300005083 | Bacteria | 1511 |
| 131 | Ga0072940_1379028 | 3300005200 | Unclassified | 3503 |
| 132 | Ga0255809_1008669 | 3300022820 | Bacteria | 1374 |
| 133 | Ga0415639_026716 | 3300038395 | Bacteria | 4559 |
| 134 | Ga0123355_10114375 | 3300009826 | Bacteria | 4206 |
| 135 | Ga0123356_10585824 | 3300010049 | Bacteria | 1279 |
| 136 | Ga0123353_10012327 | 3300010167 | Bacteria | 12141 |
| 137 | Ga0123353_10049411 | 3300010167 | Bacteria | 6700 |
| 138 | Ga0123353_10069428 | 3300010167 | Bacteria | 5661 |
| 139 | Ga0123353_10355947 | 3300010167 | Bacteria | 2203 |
| 140 | Ga0466711_332778 | 3300042615 | Bacteria | 1454 |
| 141 | Ga0466715_112471 | 3300042616 | Bacteria | 7236 |
| 142 | Ga0466715_144415 | 3300042616 | Bacteria | 40548 |
| 143 | Ga0466735_210417 | 3300042624 | Bacteria | 4288 |
| 144 | Ga0466730_039769 | 3300042625 | Bacteria | 41814 |
| 145 | Ga0466709_352307 | 3300042648 | Bacteria | 2437 |
| 146 | Ga0466724_61539 | 3300042649 | Bacteria | 3263 |
| 147 | Ga0562379_3124 | 3300056790 | Bacteria | 11766 |
| 148 | Ga0466706_002154 | 3300042599 | Bacteria | 19953 |
| 149 | Ga0466706_150021 | 3300042599 | Bacteria | 39335 |
| 150 | Ga0466706_157630 | 3300042599 | Bacteria | 63777 |
| 151 | Ga0466706_169569 | 3300042599 | Bacteria | 17329 |
| 152 | Ga0466706_279559 | 3300042599 | Bacteria | 2104 |
| 153 | Ga0466700_447445 | 3300042600 | Bacteria | 2541 |
| 154 | Ga0466714_109440 | 3300042603 | Bacteria | 1551 |
| 155 | DPO_contig09150 | 2032320009 | Bacteria | 22352 |
| 156 | SPBB_contig00117 | 2044078006 | Bacteria | 69125 |
| 157 | IMNBL1DRAFT_c0000003 | 3300000062 | Bacteria | 275310 |
| 158 | JGI24703J35330_11746920 | 3300002501 | Bacteria | 5837 |
| 159 | JGI24703J35330_11748871 | 3300002501 | Bacteria | 109529 |
| 160 | Ga0160455_100592 | 3300012837 | Bacteria | 16196 |
| 161 | Ga0415639_008847 | 3300038395 | Bacteria | 27275 |
| 162 | Ga0415639_010063 | 3300038395 | Unclassified | 10818 |
| 163 | Ga0466696_372328 | 3300042596 | Bacteria | 19194 |
| 164 | Ga0123355_10102305 | 3300009826 | Bacteria | 4506 |
| 165 | Ga0123356_10000088 | 3300010049 | Bacteria | 96559 |
| 166 | Ga0123356_10061742 | 3300010049 | Bacteria | 3500 |
| 167 | Ga0123356_10237462 | 3300010049 | Bacteria | 1891 |
| 168 | Ga0123353_10093220 | 3300010167 | Bacteria | 4852 |
| 169 | Ga0123353_10342428 | 3300010167 | Bacteria | 2258 |
| 170 | Ga0123353_10690988 | 3300010167 | Bacteria | 1434 |
| 171 | Ga0123353_10872460 | 3300010167 | Bacteria | 1230 |
| 172 | Ga0466711_277797 | 3300042615 | Bacteria | 3864 |
| 173 | Ga0466730_000184 | 3300042625 | Bacteria | 3614 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.