Protein Family IF01209
Metagenome
Isolate
283
Members
89
Samples
244
Scaffolds
399.09
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10259638|Ga0068305_102596382
- Length
- 448 aa
- Sequence
- MLQGKKIILGITGSIAAYKAAMLVRMFVKADAEVQVVMTPAAKEFITPLTLATLSRKPVISEFFSNRDGTWNSHVELGLWADAMLIAPATAASIAKMANGVADNMLITTYLSCRAPVFVAPAMDMDMYKHPATQKNLETLRSYGNVIIEPASGELASGLDGKGRMAEPETIAEVLEQFFSSNTNLVESKPHRENFFSTLRKRRENRKGLGDLLGFNILITAGPTYEKLDPVRFIGNYSSGKMGFAIAAECVKQGAQVTLIAGPVALATPEGTAKRIDVESADEMYEAAVAAFPQCDAAILCAAVADFKPRARAEEKIKREKTGDMTLELVQNPDIAAALCSMKQPHQKVAGFALETGKIVDNVNNAASKMKHKGLDMIVLNSLDEQSDVFGGDNNKVIIFENNGPYEIYNEKPKTXXXGTQRHADHQQRQGAGDGQEHLQHPANLSA*
Sample Types
Isolate
13.8%
Metagenome
86.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
30.7%
Termitidae
20.5%
Kalotermitidae
15.9%
Unclassified
11.4%
Rhinotermitidae
6.8%
Termopsidae
4.5%
Passalidae
3.4%
Drosophilidae
2.3%
Hydrophilidae
2.3%
Hodotermitidae
1.1%
Tenebrionidae
1.1%
Taxonomy
Archaea
0
Bacteria
277
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 2 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 6 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 7 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 8 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 9 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 10 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 13 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 14 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 30 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 31 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 32 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 33 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 34 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 35 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 36 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 37 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 38 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 39 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 46 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 47 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 48 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 51 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 52 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 53 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 54 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 55 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 56 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 57 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 58 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 59 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 60 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 61 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 62 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 63 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 64 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 65 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 66 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 67 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 68 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 69 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 74 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 75 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 76 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 77 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 78 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 79 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 80 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 81 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 82 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 83 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 84 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 85 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 86 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 87 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 88 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 89 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_041615 | 3300042612 | Bacteria | 11319 |
| 2 | Ga0466705_093112 | 3300042612 | Bacteria | 5514 |
| 3 | Ga0466733_140807 | 3300042659 | Bacteria | 11600 |
| 4 | Ga0466735_112809 | 3300042624 | Bacteria | 5593 |
| 5 | Ga0466703_421965 | 3300042636 | Bacteria | 9078 |
| 6 | Ga0466704_165577 | 3300042643 | Bacteria | 8486 |
| 7 | Ga0466727_057990 | 3300042655 | Bacteria | 10301 |
| 8 | Ga0466727_210639 | 3300042655 | Bacteria | 23496 |
| 9 | Ga0466727_252125 | 3300042655 | Bacteria | 8282 |
| 10 | Ga0466706_110068 | 3300042599 | Bacteria | 33466 |
| 11 | Ga0466707_414039 | 3300042601 | Unclassified | 1786 |
| 12 | Ga0466713_115233 | 3300042602 | Bacteria | 28611 |
| 13 | Ga0466716_102860 | 3300042605 | Bacteria | 7682 |
| 14 | Ga0466716_272504 | 3300042605 | Bacteria | 8804 |
| 15 | Ga0466716_543640 | 3300042605 | Bacteria | 9256 |
| 16 | Ga0466719_282293 | 3300042606 | Bacteria | 5829 |
| 17 | Ga0466722_266222 | 3300042609 | Bacteria | 11755 |
| 18 | Ga0466692_152271 | 3300042591 | Bacteria | 4749 |
| 19 | Ga0466694_066036 | 3300042594 | Bacteria | 3117 |
| 20 | Ga0466696_010546 | 3300042596 | Bacteria | 6133 |
| 21 | Ga0466696_075590 | 3300042596 | Bacteria | 9684 |
| 22 | IMNBL1DRAFT_c0011539 | 3300000062 | Bacteria | 4119 |
| 23 | JGI24702J35022_10004789 | 3300002462 | Bacteria | 7993 |
| 24 | JGI24696J40584_12961430 | 3300002834 | Bacteria | 15847 |
| 25 | Ga0068305_10011093 | 3300005083 | Bacteria | 20208 |
| 26 | Ga0466711_173461 | 3300042615 | Bacteria | 9350 |
| 27 | Ga0466711_408610 | 3300042615 | Bacteria | 17675 |
| 28 | Ga0466715_220446 | 3300042616 | Bacteria | 2350 |
| 29 | Ga0466723_051353 | 3300042618 | Bacteria | 17108 |
| 30 | Ga0466723_143614 | 3300042618 | Bacteria | 10753 |
| 31 | Ga0466723_192561 | 3300042618 | Bacteria | 11279 |
| 32 | Ga0466726_081325 | 3300042619 | Bacteria | 12183 |
| 33 | Ga0466726_294712 | 3300042619 | Bacteria | 4755 |
| 34 | Ga0466705_032507 | 3300042612 | Bacteria | 27092 |
| 35 | Ga0466705_378056 | 3300042612 | Bacteria | 11596 |
| 36 | Ga0466733_112889 | 3300042659 | Bacteria | 111775 |
| 37 | Ga0123357_10015511 | 3300009784 | Bacteria | 9992 |
| 38 | Ga0123357_10019622 | 3300009784 | Bacteria | 9014 |
| 39 | Ga0123356_10272659 | 3300010049 | Bacteria | 1783 |
| 40 | Ga0123354_10001503 | 3300010882 | Bacteria | 28513 |
| 41 | Ga0466735_006320 | 3300042624 | Bacteria | 4033 |
| 42 | Ga0466735_076469 | 3300042624 | Bacteria | 3979 |
| 43 | Ga0466735_078130 | 3300042624 | Bacteria | 2921 |
| 44 | Ga0466735_146249 | 3300042624 | Bacteria | 2766 |
| 45 | Ga0466735_213419 | 3300042624 | Bacteria | 3015 |
| 46 | Ga0466704_057608 | 3300042643 | Bacteria | 6088 |
| 47 | Ga0466704_195822 | 3300042643 | Bacteria | 13956 |
| 48 | Ga0466704_207722 | 3300042643 | Bacteria | 9000 |
| 49 | Ga0466704_362592 | 3300042643 | Bacteria | 6525 |
| 50 | Ga0466709_045467 | 3300042648 | Bacteria | 6149 |
| 51 | Ga0466709_369756 | 3300042648 | Bacteria | 11117 |
| 52 | Ga0466708_082974 | 3300042652 | Bacteria | 13466 |
| 53 | Ga0466708_159957 | 3300042652 | Bacteria | 3354 |
| 54 | Ga0466727_033053 | 3300042655 | Bacteria | 32312 |
| 55 | Ga0466727_281632 | 3300042655 | Bacteria | 7071 |
| 56 | Ga0466701_029076 | 3300042598 | Bacteria | 1160 |
| 57 | Ga0466701_083784 | 3300042598 | Bacteria | 14176 |
| 58 | Ga0466706_142707 | 3300042599 | Bacteria | 44049 |
| 59 | Ga0466707_156561 | 3300042601 | Bacteria | 6289 |
| 60 | Ga0466713_124591 | 3300042602 | Bacteria | 15803 |
| 61 | Ga0466716_471603 | 3300042605 | Bacteria | 2850 |
| 62 | Ga0466719_053145 | 3300042606 | Bacteria | 15783 |
| 63 | Ga0466690_173219 | 3300042590 | Bacteria | 7923 |
| 64 | Ga0466690_290015 | 3300042590 | Bacteria | 12271 |
| 65 | Ga0466691_019050 | 3300042593 | Bacteria | 28586 |
| 66 | Ga0466691_052750 | 3300042593 | Bacteria | 6372 |
| 67 | Ga0466691_140180 | 3300042593 | Bacteria | 12996 |
| 68 | Ga0466696_231656 | 3300042596 | Bacteria | 9298 |
| 69 | Ga0466711_044462 | 3300042615 | Bacteria | 15566 |
| 70 | Ga0466711_050974 | 3300042615 | Bacteria | 16284 |
| 71 | Ga0466711_399468 | 3300042615 | Bacteria | 4995 |
| 72 | Ga0466715_057799 | 3300042616 | Bacteria | 6869 |
| 73 | Ga0466715_417726 | 3300042616 | Bacteria | 5721 |
| 74 | Ga0466723_006080 | 3300042618 | Unclassified | 12252 |
| 75 | Ga0466723_146831 | 3300042618 | Bacteria | 32940 |
| 76 | Ga0466723_159805 | 3300042618 | Bacteria | 10102 |
| 77 | Ga0466728_395760 | 3300042620 | Bacteria | 14958 |
| 78 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 79 | Ga0123357_10023201 | 3300009784 | Bacteria | 8334 |
| 80 | Ga0123356_10049529 | 3300010049 | Bacteria | 3910 |
| 81 | Ga0466729_218008 | 3300042621 | Bacteria | 16883 |
| 82 | Ga0466703_221509 | 3300042636 | Bacteria | 34236 |
| 83 | Ga0466704_203526 | 3300042643 | Bacteria | 10666 |
| 84 | Ga0466704_584506 | 3300042643 | Bacteria | 1505 |
| 85 | Ga0466704_613463 | 3300042643 | Bacteria | 1374 |
| 86 | Ga0466709_099936 | 3300042648 | Bacteria | 10023 |
| 87 | Ga0466709_325926 | 3300042648 | Bacteria | 6862 |
| 88 | Ga0466709_418744 | 3300042648 | Bacteria | 33430 |
| 89 | Ga0466727_141033 | 3300042655 | Bacteria | 10075 |
| 90 | Ga0466722_071385 | 3300042609 | Bacteria | 10955 |
| 91 | Ga0466657_021534 | 3300042582 | Bacteria | 2382 |
| 92 | Ga0466696_253210 | 3300042596 | Bacteria | 201850 |
| 93 | Ga0466696_331279 | 3300042596 | Bacteria | 5611 |
| 94 | 2226983150 | 2225789003 | Bacteria | 9093 |
| 95 | IMNBL1DRAFT_c0000063 | 3300000062 | Bacteria | 97352 |
| 96 | IMNBL1DRAFT_c0009963 | 3300000062 | Bacteria | 4613 |
| 97 | Ga0104042_1120313 | 3300007130 | Bacteria | 2191 |
| 98 | Ga0466711_093803 | 3300042615 | Bacteria | 25402 |
| 99 | Ga0466715_085911 | 3300042616 | Bacteria | 54416 |
| 100 | Ga0466715_371338 | 3300042616 | Bacteria | 25361 |
| 101 | Ga0466723_347073 | 3300042618 | Bacteria | 20744 |
| 102 | Ga0466728_405860 | 3300042620 | Bacteria | 2098 |
| 103 | Ga0466733_034693 | 3300042659 | Bacteria | 10445 |
| 104 | Ga0466733_038690 | 3300042659 | Bacteria | 100300 |
| 105 | Ga0466735_105720 | 3300042624 | Bacteria | 1734 |
| 106 | Ga0466703_087536 | 3300042636 | Unclassified | 3811 |
| 107 | Ga0466703_092516 | 3300042636 | Bacteria | 23384 |
| 108 | Ga0466703_116075 | 3300042636 | Bacteria | 6754 |
| 109 | Ga0466703_305564 | 3300042636 | Unclassified | 1376 |
| 110 | Ga0466704_122296 | 3300042643 | Bacteria | 6958 |
| 111 | Ga0466708_171693 | 3300042652 | Bacteria | 14686 |
| 112 | Ga0466727_337335 | 3300042655 | Bacteria | 1921 |
| 113 | Ga0466719_423528 | 3300042606 | Bacteria | 12890 |
| 114 | Ga0466722_009466 | 3300042609 | Bacteria | 39262 |
| 115 | Ga0466722_209447 | 3300042609 | Bacteria | 25046 |
| 116 | Ga0466690_124251 | 3300042590 | Bacteria | 8184 |
| 117 | Ga0466692_033060 | 3300042591 | Bacteria | 12445 |
| 118 | Ga0466692_042688 | 3300042591 | Bacteria | 33654 |
| 119 | Ga0466692_070662 | 3300042591 | Bacteria | 28923 |
| 120 | Ga0466696_243806 | 3300042596 | Bacteria | 21089 |
| 121 | Ga0466701_002890 | 3300042598 | Bacteria | 12408 |
| 122 | IMNBL1DRAFT_c0006355 | 3300000062 | Bacteria | 6474 |
| 123 | JGI24702J35022_10002417 | 3300002462 | Bacteria | 11409 |
| 124 | Ga0068305_10017932 | 3300005083 | Bacteria | 13068 |
| 125 | Ga0466705_475366 | 3300042612 | Bacteria | 1792 |
| 126 | Ga0466711_090238 | 3300042615 | Bacteria | 5296 |
| 127 | Ga0466711_109004 | 3300042615 | Bacteria | 7837 |
| 128 | Ga0466723_170964 | 3300042618 | Bacteria | 9288 |
| 129 | Ga0466723_332100 | 3300042618 | Bacteria | 4735 |
| 130 | Ga0466733_010468 | 3300042659 | Bacteria | 13856 |
| 131 | Ga0123356_10078971 | 3300010049 | Bacteria | 3108 |
| 132 | Ga0123354_10004657 | 3300010882 | Bacteria | 19538 |
| 133 | Ga0466735_036065 | 3300042624 | Bacteria | 16628 |
| 134 | Ga0466703_008945 | 3300042636 | Bacteria | 15665 |
| 135 | Ga0466703_077030 | 3300042636 | Bacteria | 7900 |
| 136 | Ga0466703_146887 | 3300042636 | Bacteria | 5411 |
| 137 | Ga0466706_065550 | 3300042599 | Bacteria | 22203 |
| 138 | Ga0466706_273544 | 3300042599 | Bacteria | 20008 |
| 139 | Ga0466706_275766 | 3300042599 | Bacteria | 6742 |
| 140 | Ga0466707_083281 | 3300042601 | Bacteria | 9933 |
| 141 | Ga0466707_130803 | 3300042601 | Bacteria | 11143 |
| 142 | Ga0466707_383522 | 3300042601 | Bacteria | 5044 |
| 143 | Ga0466713_042924 | 3300042602 | Bacteria | 2569 |
| 144 | Ga0466719_078393 | 3300042606 | Bacteria | 4807 |
| 145 | Ga0466690_027177 | 3300042590 | Bacteria | 32769 |
| 146 | Ga0466692_124908 | 3300042591 | Bacteria | 9590 |
| 147 | Ga0466691_116878 | 3300042593 | Bacteria | 3637 |
| 148 | Ga0466696_025383 | 3300042596 | Bacteria | 6913 |
| 149 | Ga0068305_10010999 | 3300005083 | Bacteria | 28319 |
| 150 | Ga0104050_1200558 | 3300007153 | Bacteria | 2238 |
| 151 | Ga0466728_222413 | 3300042620 | Bacteria | 18136 |
| 152 | Ga0466729_170334 | 3300042621 | Bacteria | 11027 |
| 153 | Ga0123357_10011205 | 3300009784 | Bacteria | 11477 |
| 154 | Ga0123354_10065764 | 3300010882 | Bacteria | 5303 |
| 155 | Ga0123354_10252842 | 3300010882 | Unclassified | 1780 |
| 156 | Ga0466704_549004 | 3300042643 | Bacteria | 3827 |
| 157 | Ga0466709_127524 | 3300042648 | Bacteria | 4560 |
| 158 | Ga0466708_443563 | 3300042652 | Bacteria | 5977 |
| 159 | Ga0466701_045246 | 3300042598 | Bacteria | 23760 |
| 160 | Ga0466706_033628 | 3300042599 | Bacteria | 10195 |
| 161 | Ga0466700_331047 | 3300042600 | Bacteria | 21829 |
| 162 | Ga0466707_297094 | 3300042601 | Bacteria | 4597 |
| 163 | Ga0466713_016019 | 3300042602 | Bacteria | 439221 |
| 164 | Ga0466713_027912 | 3300042602 | Bacteria | 47751 |
| 165 | Ga0466713_039105 | 3300042602 | Bacteria | 4658 |
| 166 | Ga0466716_095094 | 3300042605 | Bacteria | 3922 |
| 167 | Ga0466719_025468 | 3300042606 | Bacteria | 4125 |
| 168 | Ga0466722_187255 | 3300042609 | Bacteria | 11075 |
| 169 | Ga0466690_047987 | 3300042590 | Bacteria | 10310 |
| 170 | Ga0466690_412796 | 3300042590 | Bacteria | 17631 |
| 171 | Ga0466692_042162 | 3300042591 | Bacteria | 26764 |
| 172 | Ga0466696_169656 | 3300042596 | Bacteria | 1803 |
| 173 | Ga0466696_303312 | 3300042596 | Bacteria | 10145 |
| 174 | 2227128034 | 2225789004 | Bacteria | 9011 |
| 175 | JGI24702J35022_10000410 | 3300002462 | Bacteria | 25605 |
| 176 | JGI24702J35022_10002024 | 3300002462 | Bacteria | 12486 |
| 177 | JGI24699J35502_11130704 | 3300002509 | Bacteria | 5245 |
| 178 | Ga0068305_10002699 | 3300005083 | Bacteria | 13227 |
| 179 | Ga0068305_10259638 | 3300005083 | Bacteria | 2095 |
| 180 | Ga0072940_1282460 | 3300005200 | Bacteria | 2558 |
| 181 | Ga0466711_259192 | 3300042615 | Bacteria | 8724 |
| 182 | Ga0466711_267924 | 3300042615 | Bacteria | 5226 |
| 183 | Ga0466715_221888 | 3300042616 | Bacteria | 8533 |
| 184 | Ga0466715_547899 | 3300042616 | Bacteria | 47276 |
| 185 | Ga0466723_046227 | 3300042618 | Bacteria | 2421 |
| 186 | Ga0466705_040770 | 3300042612 | Bacteria | 11513 |
| 187 | Ga0466703_423420 | 3300042636 | Bacteria | 2203 |
| 188 | Ga0466704_288938 | 3300042643 | Bacteria | 7496 |
| 189 | Ga0466704_572589 | 3300042643 | Bacteria | 2519 |
| 190 | Ga0466709_075870 | 3300042648 | Bacteria | 101053 |
| 191 | Ga0466727_218918 | 3300042655 | Bacteria | 13170 |
| 192 | Ga0466701_074060 | 3300042598 | Bacteria | 1695 |
| 193 | Ga0466707_064540 | 3300042601 | Bacteria | 6487 |
| 194 | Ga0466707_204653 | 3300042601 | Bacteria | 19268 |
| 195 | Ga0466713_055409 | 3300042602 | Bacteria | 17704 |
| 196 | Ga0466716_073567 | 3300042605 | Bacteria | 13972 |
| 197 | Ga0466722_066324 | 3300042609 | Bacteria | 41323 |
| 198 | Ga0466656_371628 | 3300042550 | Bacteria | 6734 |
| 199 | Ga0466690_203578 | 3300042590 | Bacteria | 19293 |
| 200 | Ga0466690_218956 | 3300042590 | Bacteria | 9965 |
| 201 | Ga0466691_008150 | 3300042593 | Bacteria | 14239 |
| 202 | Ga0466691_023858 | 3300042593 | Bacteria | 13253 |
| 203 | Ga0466691_058104 | 3300042593 | Bacteria | 6875 |
| 204 | IMNBL1DRAFT_c0001371 | 3300000062 | Bacteria | 18314 |
| 205 | IMNBL1DRAFT_c0006684 | 3300000062 | Bacteria | 6248 |
| 206 | IMNBL1DRAFT_c0020039 | 3300000062 | Bacteria | 2721 |
| 207 | Ga0068302_10152344 | 3300005071 | Bacteria | 5283 |
| 208 | Ga0072941_1085274 | 3300005201 | Bacteria | 3139 |
| 209 | Ga0466715_087433 | 3300042616 | Bacteria | 28443 |
| 210 | Ga0466726_437067 | 3300042619 | Bacteria | 1620 |
| 211 | Ga0466697_250936 | 3300042611 | Bacteria | 2956 |
| 212 | Ga0466705_137976 | 3300042612 | Bacteria | 6304 |
| 213 | Ga0466705_270818 | 3300042612 | Bacteria | 6087 |
| 214 | Ga0123357_10189810 | 3300009784 | Bacteria | 2371 |
| 215 | Ga0123355_10002912 | 3300009826 | Bacteria | 24312 |
| 216 | Ga0123356_10013528 | 3300010049 | Bacteria | 7872 |
| 217 | Ga0123354_10148851 | 3300010882 | Bacteria | 2849 |
| 218 | Ga0123354_10307693 | 3300010882 | Bacteria | 1486 |
| 219 | Ga0466735_050790 | 3300042624 | Bacteria | 2199 |
| 220 | Ga0466703_002922 | 3300042636 | Bacteria | 6953 |
| 221 | Ga0466703_005366 | 3300042636 | Bacteria | 6058 |
| 222 | Ga0466703_166876 | 3300042636 | Bacteria | 14308 |
| 223 | Ga0466703_362877 | 3300042636 | Bacteria | 1731 |
| 224 | Ga0466704_175561 | 3300042643 | Bacteria | 14634 |
| 225 | Ga0466704_378968 | 3300042643 | Bacteria | 8733 |
| 226 | Ga0466709_328210 | 3300042648 | Bacteria | 5873 |
| 227 | Ga0466708_135966 | 3300042652 | Bacteria | 11275 |
| 228 | Ga0466725_311188 | 3300042654 | Bacteria | 11217 |
| 229 | Ga0466701_038344 | 3300042598 | Bacteria | 5089 |
| 230 | Ga0466713_078868 | 3300042602 | Bacteria | 140260 |
| 231 | Ga0466714_041819 | 3300042603 | Bacteria | 104465 |
| 232 | Ga0466692_193310 | 3300042591 | Bacteria | 49575 |
| 233 | JGI24698J34947_10019348 | 3300002449 | Bacteria | 3673 |
| 234 | Ga0068305_10017541 | 3300005083 | Bacteria | 7947 |
| 235 | Ga0068305_10052569 | 3300005083 | Unclassified | 2796 |
| 236 | Ga0123357_10002994 | 3300009784 | Bacteria | 19122 |
| 237 | Ga0466705_501169 | 3300042612 | Bacteria | 5012 |
| 238 | Ga0466711_081954 | 3300042615 | Bacteria | 6041 |
| 239 | Ga0466711_184442 | 3300042615 | Bacteria | 5940 |
| 240 | Ga0466711_398758 | 3300042615 | Bacteria | 47200 |
| 241 | Ga0466715_275851 | 3300042616 | Bacteria | 12229 |
| 242 | Ga0466726_442609 | 3300042619 | Bacteria | 14068 |
| 243 | Ga0466728_244051 | 3300042620 | Bacteria | 24646 |
| 244 | Ga0466729_083318 | 3300042621 | Bacteria | 4265 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02441 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.