Protein Family IF01179
Metagenome
Isolate
192
Members
62
Samples
187
Scaffolds
114.19
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10011100|Ga0068305_100111003
- Length
- 133 aa
- Sequence
- MQNNGTHDIKVYLKDIEQSIKEIYEFLPAKRNFLVFRQDIKTRKAVERNIEIIGEAMSRILKINPDFPIEASRKIVDTRNRIIHGYDTVSADVLWLIIVNYLPNLEKQVKKLLNKNLAEGDMPIYVVGNEEL*
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
56.7%
Kalotermitidae
18.3%
Unclassified
10.0%
Termopsidae
5.0%
Passalidae
3.3%
Hodotermitidae
1.7%
Harpacticidae
1.7%
Daphniidae
1.7%
Rhinotermitidae
1.7%
Taxonomy
Archaea
1
Bacteria
177
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 6 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 18 | 2021593000 | Sample 264 | Metagenome | Harpacticidae |
| 19 | 2820014844 | Unclassified Spirochaetes Nt197P3bin95 | Isolate | Unclassified |
| 20 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 23 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 24 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 27 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 28 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 29 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 30 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 31 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 38 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 39 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 44 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 47 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 48 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 51 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 52 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 53 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 54 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 55 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 56 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 57 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 58 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 59 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 60 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 61 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 62 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_240060 | 3300042600 | Bacteria | 3730 |
| 2 | Ga0466707_359819 | 3300042601 | Bacteria | 6834 |
| 3 | Ga0466713_008847 | 3300042602 | Bacteria | 37006 |
| 4 | Ga0415639_149242 | 3300038395 | Bacteria | 1899 |
| 5 | Ga0466656_019949 | 3300042550 | Unclassified | 2112 |
| 6 | Ga0466691_019269 | 3300042593 | Bacteria | 5344 |
| 7 | Ga0466734_103668 | 3300042623 | Bacteria | 1512 |
| 8 | Ga0466702_187764 | 3300042635 | Bacteria | 1026 |
| 9 | Ga0466708_119216 | 3300042652 | Bacteria | 5088 |
| 10 | Ga0466708_225560 | 3300042652 | Bacteria | 1826 |
| 11 | Ga0466725_355252 | 3300042654 | Bacteria | 3440 |
| 12 | 2227463021 | 2225789004 | Unclassified | 999 |
| 13 | 2227472668 | 2225789004 | Bacteria | 910 |
| 14 | 2227615180 | 2225789004 | Bacteria | 2230 |
| 15 | IMNBL1DRAFT_c0038143 | 3300000062 | Bacteria | 1656 |
| 16 | IMNBL1DRAFT_c0044349 | 3300000062 | Bacteria | 1462 |
| 17 | JGI24705J35276_11960054 | 3300002504 | Bacteria | 804 |
| 18 | JGI24705J35276_12223789 | 3300002504 | Bacteria | 2544 |
| 19 | JGI24696J40584_12870210 | 3300002834 | Bacteria | 1043 |
| 20 | Ga0466700_351363 | 3300042600 | Bacteria | 1524 |
| 21 | Ga0466707_052994 | 3300042601 | Bacteria | 7002 |
| 22 | Ga0466707_166947 | 3300042601 | Bacteria | 8033 |
| 23 | Ga0466714_114181 | 3300042603 | Bacteria | 1170 |
| 24 | Ga0466714_129360 | 3300042603 | Bacteria | 1399 |
| 25 | Ga0466698_061707 | 3300042610 | Bacteria | 1541 |
| 26 | Ga0466710_366760 | 3300042613 | Bacteria | 1561 |
| 27 | Ga0123356_12428981 | 3300010049 | Bacteria | 656 |
| 28 | Ga0466656_041261 | 3300042550 | Bacteria | 9653 |
| 29 | Ga0466657_224087 | 3300042582 | Bacteria | 1505 |
| 30 | Ga0466734_083373 | 3300042623 | Bacteria | 3180 |
| 31 | Ga0466735_063684 | 3300042624 | Unclassified | 2545 |
| 32 | Ga0466735_099930 | 3300042624 | Bacteria | 1028 |
| 33 | Ga0466708_111795 | 3300042652 | Bacteria | 4201 |
| 34 | Ga0466727_326751 | 3300042655 | Bacteria | 2705 |
| 35 | IMNBL1DRAFT_c0000614 | 3300000062 | Bacteria | 28589 |
| 36 | IMNBL1DRAFT_c0016961 | 3300000062 | Bacteria | 3089 |
| 37 | JGI24698J34947_10213332 | 3300002449 | Bacteria | 746 |
| 38 | JGI24702J35022_10003137 | 3300002462 | Bacteria | 9994 |
| 39 | JGI24702J35022_10161759 | 3300002462 | Bacteria | 1261 |
| 40 | JGI24702J35022_10910742 | 3300002462 | Bacteria | 548 |
| 41 | Ga0466707_174284 | 3300042601 | Bacteria | 32623 |
| 42 | Ga0466716_045672 | 3300042605 | Bacteria | 1884 |
| 43 | Ga0466719_172243 | 3300042606 | Bacteria | 1290 |
| 44 | Ga0466719_212950 | 3300042606 | Bacteria | 1848 |
| 45 | Ga0466697_024767 | 3300042611 | Bacteria | 23080 |
| 46 | Ga0466711_222547 | 3300042615 | Bacteria | 19633 |
| 47 | Ga0466711_307060 | 3300042615 | Bacteria | 1643 |
| 48 | Ga0466726_292789 | 3300042619 | Bacteria | 6685 |
| 49 | Ga0123357_10749873 | 3300009784 | Bacteria | 679 |
| 50 | Ga0123356_10257323 | 3300010049 | Bacteria | 1827 |
| 51 | Ga0123356_11792406 | 3300010049 | Bacteria | 763 |
| 52 | Ga0123353_11149652 | 3300010167 | Bacteria | 1025 |
| 53 | Ga0123353_12824807 | 3300010167 | Bacteria | 568 |
| 54 | Ga0123354_10572540 | 3300010882 | Bacteria | 841 |
| 55 | Ga0265387_1002826 | 3300024582 | Bacteria | 2428 |
| 56 | Ga0466656_160074 | 3300042550 | Bacteria | 1386 |
| 57 | Ga0466735_101307 | 3300042624 | Bacteria | 2316 |
| 58 | TM1208_contig18355 | 2021593000 | Bacteria | 1386 |
| 59 | IMNBL1DRAFT_c0184225 | 3300000062 | Bacteria | 527 |
| 60 | JGI24696J40584_12678254 | 3300002834 | Bacteria | 717 |
| 61 | Ga0068305_10090517 | 3300005083 | Bacteria | 8688 |
| 62 | Ga0466697_202708 | 3300042611 | Bacteria | 1948 |
| 63 | Ga0466697_213705 | 3300042611 | Unclassified | 1906 |
| 64 | Ga0466697_239644 | 3300042611 | Bacteria | 1270 |
| 65 | Ga0466705_003781 | 3300042612 | Bacteria | 2855 |
| 66 | Ga0466701_044043 | 3300042598 | Bacteria | 1689 |
| 67 | Ga0466707_188132 | 3300042601 | Bacteria | 5652 |
| 68 | Ga0466714_057554 | 3300042603 | Bacteria | 76415 |
| 69 | Ga0466715_098627 | 3300042616 | Bacteria | 3776 |
| 70 | Ga0123356_10969378 | 3300010049 | Bacteria | 1021 |
| 71 | Ga0123356_13072756 | 3300010049 | Bacteria | 582 |
| 72 | Ga0123353_11550882 | 3300010167 | Bacteria | 840 |
| 73 | Ga0123354_10880364 | 3300010882 | Bacteria | 590 |
| 74 | Ga0466699_399431 | 3300042597 | Bacteria | 1918 |
| 75 | Ga0466734_146959 | 3300042623 | Bacteria | 1665 |
| 76 | Ga0466704_128253 | 3300042643 | Bacteria | 8868 |
| 77 | 2227510941 | 2225789004 | Bacteria | 700 |
| 78 | IMNBL1DRAFT_c0075059 | 3300000062 | Bacteria | 962 |
| 79 | JGI24702J35022_10025741 | 3300002462 | Bacteria | 3172 |
| 80 | JGI24699J35502_11134115 | 3300002509 | Bacteria | 32686 |
| 81 | JGI24696J40584_12901506 | 3300002834 | Bacteria | 1189 |
| 82 | JGI24696J40584_12951019 | 3300002834 | Bacteria | 2202 |
| 83 | Ga0072941_1121200 | 3300005201 | Bacteria | 2062 |
| 84 | Ga0466732_331536 | 3300042656 | Bacteria | 6574 |
| 85 | Ga0466733_076231 | 3300042659 | Bacteria | 15181 |
| 86 | Ga0466701_064304 | 3300042598 | Bacteria | 1653 |
| 87 | Ga0466700_179274 | 3300042600 | Bacteria | 9448 |
| 88 | Ga0466700_461296 | 3300042600 | Bacteria | 2977 |
| 89 | Ga0466714_008101 | 3300042603 | Bacteria | 18228 |
| 90 | Ga0466720_054845 | 3300042607 | Bacteria | 2337 |
| 91 | Ga0466711_087501 | 3300042615 | Bacteria | 13442 |
| 92 | Ga0466728_033032 | 3300042620 | Bacteria | 14799 |
| 93 | Ga0123356_10182749 | 3300010049 | Unclassified | 2120 |
| 94 | Ga0123353_10963201 | 3300010167 | Unclassified | 1152 |
| 95 | Ga0123353_11123228 | 3300010167 | Bacteria | 1041 |
| 96 | Ga0123354_10000165 | 3300010882 | Bacteria | 53803 |
| 97 | Ga0123354_10250019 | 3300010882 | Bacteria | 1799 |
| 98 | Ga0123354_10461075 | 3300010882 | Bacteria | 1021 |
| 99 | Ga0466657_280960 | 3300042582 | Bacteria | 1160 |
| 100 | Ga0466657_366577 | 3300042582 | Bacteria | 1442 |
| 101 | Ga0466691_030376 | 3300042593 | Bacteria | 1524 |
| 102 | Ga0466691_098981 | 3300042593 | Bacteria | 1080 |
| 103 | Ga0466695_255432 | 3300042595 | Bacteria | 2304 |
| 104 | Ga0466699_303228 | 3300042597 | Bacteria | 1074 |
| 105 | Ga0466734_006615 | 3300042623 | Bacteria | 2446 |
| 106 | IMNBL1DRAFT_c0000785 | 3300000062 | Bacteria | 25114 |
| 107 | JGI24705J35276_12237514 | 3300002504 | Bacteria | 11530 |
| 108 | JGI24696J40584_12948184 | 3300002834 | Bacteria | 1990 |
| 109 | Ga0466705_008661 | 3300042612 | Bacteria | 18673 |
| 110 | Ga0466733_122385 | 3300042659 | Bacteria | 2144 |
| 111 | Ga0466701_094525 | 3300042598 | Bacteria | 10245 |
| 112 | Ga0466706_239131 | 3300042599 | Archaea | 1084 |
| 113 | Ga0466721_225274 | 3300042608 | Unclassified | 1156 |
| 114 | Ga0466698_455101 | 3300042610 | Bacteria | 1210 |
| 115 | Ga0466712_302966 | 3300042614 | Bacteria | 2467 |
| 116 | Ga0123357_10011289 | 3300009784 | Unclassified | 11441 |
| 117 | Ga0123357_10025783 | 3300009784 | Bacteria | 7934 |
| 118 | Ga0123357_10660423 | 3300009784 | Bacteria | 769 |
| 119 | Ga0123356_12195463 | 3300010049 | Bacteria | 690 |
| 120 | Ga0123356_12496546 | 3300010049 | Bacteria | 647 |
| 121 | Ga0123353_10454224 | 3300010167 | Bacteria | 1885 |
| 122 | Ga0123353_10716530 | 3300010167 | Bacteria | 1401 |
| 123 | Ga0123353_12571763 | 3300010167 | Bacteria | 603 |
| 124 | Ga0123353_13176250 | 3300010167 | Bacteria | 527 |
| 125 | Ga0466690_048633 | 3300042590 | Bacteria | 8589 |
| 126 | Ga0466690_068735 | 3300042590 | Bacteria | 3164 |
| 127 | Ga0466693_395701 | 3300042592 | Unclassified | 1397 |
| 128 | Ga0466694_178411 | 3300042594 | Bacteria | 2056 |
| 129 | Ga0466734_071647 | 3300042623 | Bacteria | 3654 |
| 130 | Ga0466704_265825 | 3300042643 | Bacteria | 1238 |
| 131 | Ga0466724_59759 | 3300042649 | Bacteria | 3376 |
| 132 | Ga0466727_346081 | 3300042655 | Bacteria | 5877 |
| 133 | IMNBL1DRAFT_c0020488 | 3300000062 | Unclassified | 2677 |
| 134 | JGI24702J35022_10402119 | 3300002462 | Bacteria | 827 |
| 135 | JGI24705J35276_12208930 | 3300002504 | Bacteria | 1785 |
| 136 | JGI24696J40584_12540239 | 3300002834 | Bacteria | 620 |
| 137 | Ga0068305_10011100 | 3300005083 | Bacteria | 3341 |
| 138 | Ga0466697_143821 | 3300042611 | Bacteria | 1210 |
| 139 | Ga0466732_209695 | 3300042656 | Bacteria | 1362 |
| 140 | Ga0466733_047727 | 3300042659 | Bacteria | 2840 |
| 141 | Ga0466733_153237 | 3300042659 | Bacteria | 8999 |
| 142 | Ga0466733_211154 | 3300042659 | Bacteria | 3762 |
| 143 | Ga0466700_072045 | 3300042600 | Bacteria | 1606 |
| 144 | Ga0123356_10402006 | 3300010049 | Bacteria | 1507 |
| 145 | Ga0123356_11439348 | 3300010049 | Bacteria | 848 |
| 146 | Ga0123356_12610520 | 3300010049 | Bacteria | 632 |
| 147 | Ga0123353_10000120 | 3300010167 | Bacteria | 93172 |
| 148 | Ga0123353_10300496 | 3300010167 | Bacteria | 2450 |
| 149 | Ga0123353_10858223 | 3300010167 | Bacteria | 1243 |
| 150 | Ga0123354_10202832 | 3300010882 | Bacteria | 2173 |
| 151 | Ga0466731_232186 | 3300042622 | Bacteria | 1606 |
| 152 | Ga0466735_154299 | 3300042624 | Bacteria | 3805 |
| 153 | Ga0466704_324131 | 3300042643 | Bacteria | 2679 |
| 154 | Ga0466725_211762 | 3300042654 | Bacteria | 62408 |
| 155 | IMNBL1DRAFT_c0034897 | 3300000062 | Bacteria | 1782 |
| 156 | Ga0466733_028599 | 3300042659 | Bacteria | 2334 |
| 157 | Ga0466733_067514 | 3300042659 | Bacteria | 2316 |
| 158 | Ga0466733_151861 | 3300042659 | Bacteria | 1009 |
| 159 | Ga0466701_039482 | 3300042598 | Bacteria | 104864 |
| 160 | Ga0466700_125014 | 3300042600 | Bacteria | 2208 |
| 161 | Ga0466717_101962 | 3300042604 | Unclassified | 1150 |
| 162 | Ga0466719_535417 | 3300042606 | Bacteria | 4710 |
| 163 | Ga0466710_232688 | 3300042613 | Bacteria | 1179 |
| 164 | Ga0466710_258538 | 3300042613 | Bacteria | 2135 |
| 165 | Ga0466710_441018 | 3300042613 | Bacteria | 1214 |
| 166 | Ga0466711_144269 | 3300042615 | Bacteria | 1639 |
| 167 | Ga0466715_255724 | 3300042616 | Bacteria | 1376 |
| 168 | Ga0466728_197188 | 3300042620 | Bacteria | 2031 |
| 169 | Ga0466729_115967 | 3300042621 | Bacteria | 20997 |
| 170 | Ga0123357_10461810 | 3300009784 | Bacteria | 1091 |
| 171 | Ga0123356_10396320 | 3300010049 | Bacteria | 1517 |
| 172 | Ga0123356_10893562 | 3300010049 | Bacteria | 1060 |
| 173 | Ga0123356_13576095 | 3300010049 | Bacteria | 538 |
| 174 | Ga0123353_10091765 | 3300010167 | Bacteria | 4892 |
| 175 | Ga0123353_11421893 | 3300010167 | Unclassified | 890 |
| 176 | Ga0123353_11970269 | 3300010167 | Bacteria | 717 |
| 177 | Ga0123354_10680713 | 3300010882 | Unclassified | 725 |
| 178 | Ga0123354_10775931 | 3300010882 | Unclassified | 651 |
| 179 | Ga0466731_405299 | 3300042622 | Bacteria | 1520 |
| 180 | Ga0466734_162017 | 3300042623 | Bacteria | 1051 |
| 181 | Ga0466703_205615 | 3300042636 | Bacteria | 1048 |
| 182 | Ga0466725_348986 | 3300042654 | Bacteria | 3667 |
| 183 | Ga0466727_313780 | 3300042655 | Bacteria | 3108 |
| 184 | IMNBL1DRAFT_c0016572 | 3300000062 | Bacteria | 3147 |
| 185 | IMNBL1DRAFT_c0030920 | 3300000062 | Bacteria | 1955 |
| 186 | JGI24705J35276_11914607 | 3300002504 | Bacteria | 763 |
| 187 | Ga0072940_1525952 | 3300005200 | Bacteria | 593 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01934 | HepT-like | Ribonuclease HepT-like | 16 | 111 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.