Protein Family IF01176
Metagenome
Isolate
237
Members
73
Samples
215
Scaffolds
403.75
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10009083|Ga0068305_1000908313
- Length
- 485 aa
- Sequence
- MANFTSRIAIGAAVMLLAEKAKNNMPFACTPAVENFLAYLVGKLHPSPVPCLLEFWSWIQHNCFGAKMIIKPRIRNNICLNSHPKGCAKAVESEIEYVKKAFAGWALEAALKPKLVLVIGCSTGYGLASRIAAAFGCGAATVGVSFETAGSEKKPGTPGFYNNLAFDKFAAKEGLAFKTLNIDAFSHEGKDAAIGALRDVAKAAGIDAKVDLIIYSLASPVRTDPKTGIMHRSVIKPIGGAYSGLTVDMLTGKLGNVSVEGATDEEAFNTVKVMGGEDWELWIDALDGAGVLSGNFKTVAYTYIGPELSWAIYKNGTIGRAKEDLERACGAINKKTGKQCAFVSVNKAVVTRSSAVIPIIPLYISCLFRVMKDMKLHEGCIEQICRLFKERLYTKEAASSASGASTSKVPLDEKGRIRIDDWEMRDDVQAATADKLSKINDDNIFTESDLAGFKHDFLEAHGFDIPGIDYDEDIDVDCLLGVKI*
Sample Types
Isolate
9.3%
Metagenome
90.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.9%
Unclassified
21.4%
Kalotermitidae
20.0%
Culicidae
11.4%
Rhinotermitidae
5.7%
Termopsidae
4.3%
Passalidae
2.9%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
231
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2964266314 | Entomospira nematocera BR208 | Isolate | Culicidae |
| 2 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 3 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 4 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 5 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2964145936 | Entomospira culicis BR149 | Isolate | Culicidae |
| 16 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 8063587521 | Entomospira entomophilus BR193 | Isolate | Culicidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 27 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 28 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2964144231 | Entomospira culicis BR151 | Isolate | Culicidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 41 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 42 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 43 | 8063595521 | Entomospira culicis BR149 | Isolate | Culicidae |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 46 | 2964130733 | Entomospira entomophilus BR193 | Isolate | Culicidae |
| 47 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 48 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 49 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 50 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 51 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 52 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 53 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 54 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 55 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 56 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 57 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 58 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 59 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 60 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 61 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 62 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 63 | 8063589291 | Entomospira nematocera BR208 | Isolate | Culicidae |
| 64 | 8063597228 | Entomospira culicis BR151 | Isolate | Culicidae |
| 65 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 66 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 67 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 68 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 69 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 70 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 71 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 72 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 73 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_224636 | 3300042656 | Bacteria | 1329 |
| 2 | AustNasuHG_c1000550 | 3300000089 | Bacteria | 13186 |
| 3 | JGI24695J34938_10035080 | 3300002450 | Bacteria | 2297 |
| 4 | JGI24695J34938_10072367 | 3300002450 | Bacteria | 1438 |
| 5 | Ga0466716_293854 | 3300042605 | Bacteria | 8099 |
| 6 | Ga0466719_219934 | 3300042606 | Bacteria | 2997 |
| 7 | Ga0466721_143465 | 3300042608 | Bacteria | 13673 |
| 8 | Ga0466722_101842 | 3300042609 | Bacteria | 5242 |
| 9 | Ga0466698_245795 | 3300042610 | Bacteria | 1729 |
| 10 | Ga0264413_101960 | 3300024493 | Bacteria | 10248 |
| 11 | Ga0264413_113114 | 3300024493 | Bacteria | 29034 |
| 12 | Ga0456237_0015227 | 3300041968 | Unclassified | 1091 |
| 13 | Ga0466690_018890 | 3300042590 | Bacteria | 8193 |
| 14 | Ga0466690_102739 | 3300042590 | Bacteria | 3106 |
| 15 | Ga0466692_067810 | 3300042591 | Bacteria | 6352 |
| 16 | Ga0466691_012248 | 3300042593 | Bacteria | 11427 |
| 17 | Ga0466699_324897 | 3300042597 | Bacteria | 3661 |
| 18 | Ga0123355_10013733 | 3300009826 | Bacteria | 12618 |
| 19 | Ga0123356_10000286 | 3300010049 | Bacteria | 58205 |
| 20 | Ga0466731_368880 | 3300042622 | Bacteria | 1839 |
| 21 | Ga0466703_247107 | 3300042636 | Bacteria | 11599 |
| 22 | Ga0466704_214161 | 3300042643 | Bacteria | 5980 |
| 23 | Ga0466708_007803 | 3300042652 | Bacteria | 12948 |
| 24 | Ga0466708_012255 | 3300042652 | Bacteria | 4318 |
| 25 | Ga0466708_277402 | 3300042652 | Bacteria | 6521 |
| 26 | Ga0466708_354579 | 3300042652 | Bacteria | 12338 |
| 27 | Ga0466712_036305 | 3300042614 | Bacteria | 5132 |
| 28 | Ga0466715_051983 | 3300042616 | Bacteria | 7067 |
| 29 | Ga0466723_045181 | 3300042618 | Bacteria | 25791 |
| 30 | Ga0466726_386911 | 3300042619 | Bacteria | 2366 |
| 31 | FAAS_10004302 | 3300001880 | Unclassified | 2252 |
| 32 | Ga0466706_019912 | 3300042599 | Bacteria | 2038 |
| 33 | Ga0466706_143199 | 3300042599 | Bacteria | 4052 |
| 34 | Ga0466719_059042 | 3300042606 | Bacteria | 1864 |
| 35 | Ga0466722_200710 | 3300042609 | Bacteria | 2207 |
| 36 | Ga0466722_203604 | 3300042609 | Bacteria | 7120 |
| 37 | Ga0466690_116640 | 3300042590 | Unclassified | 4355 |
| 38 | Ga0466692_084981 | 3300042591 | Bacteria | 1825 |
| 39 | Ga0466692_162986 | 3300042591 | Bacteria | 17124 |
| 40 | Ga0466691_175199 | 3300042593 | Bacteria | 27229 |
| 41 | Ga0466695_008971 | 3300042595 | Bacteria | 2618 |
| 42 | Ga0466696_128265 | 3300042596 | Bacteria | 2370 |
| 43 | Ga0466699_219322 | 3300042597 | Bacteria | 2549 |
| 44 | Ga0123356_10003902 | 3300010049 | Bacteria | 15534 |
| 45 | Ga0123356_10006941 | 3300010049 | Bacteria | 11371 |
| 46 | Ga0123353_10418511 | 3300010167 | Bacteria | 1986 |
| 47 | Ga0466735_045314 | 3300042624 | Bacteria | 4815 |
| 48 | Ga0466727_086830 | 3300042655 | Bacteria | 5055 |
| 49 | Ga0466727_332188 | 3300042655 | Bacteria | 29400 |
| 50 | Ga0466715_550910 | 3300042616 | Bacteria | 15899 |
| 51 | Ga0466723_176242 | 3300042618 | Bacteria | 78804 |
| 52 | Ga0466723_261184 | 3300042618 | Bacteria | 24963 |
| 53 | Ga0466726_097212 | 3300042619 | Bacteria | 6782 |
| 54 | IMNBL1DRAFT_c0000341 | 3300000062 | Bacteria | 39600 |
| 55 | JGI24698J34947_10001631 | 3300002449 | Bacteria | 11940 |
| 56 | JGI24695J34938_10019014 | 3300002450 | Bacteria | 3416 |
| 57 | JGI24702J35022_10006451 | 3300002462 | Bacteria | 6783 |
| 58 | Ga0466714_112561 | 3300042603 | Bacteria | 4908 |
| 59 | Ga0466716_453040 | 3300042605 | Bacteria | 7860 |
| 60 | Ga0466719_114445 | 3300042606 | Bacteria | 8099 |
| 61 | Ga0466722_183400 | 3300042609 | Bacteria | 9904 |
| 62 | Ga0466722_267366 | 3300042609 | Bacteria | 2599 |
| 63 | Ga0415639_062210 | 3300038395 | Bacteria | 10116 |
| 64 | Ga0466692_030274 | 3300042591 | Bacteria | 14450 |
| 65 | Ga0466692_149105 | 3300042591 | Bacteria | 3207 |
| 66 | Ga0466693_128283 | 3300042592 | Bacteria | 2346 |
| 67 | Ga0466693_334370 | 3300042592 | Bacteria | 5446 |
| 68 | Ga0466691_002246 | 3300042593 | Bacteria | 7226 |
| 69 | Ga0466696_269730 | 3300042596 | Bacteria | 12563 |
| 70 | Ga0466699_182449 | 3300042597 | Bacteria | 2456 |
| 71 | Ga0123353_10129690 | 3300010167 | Bacteria | 4048 |
| 72 | Ga0466704_088671 | 3300042643 | Bacteria | 8929 |
| 73 | Ga0466708_204979 | 3300042652 | Bacteria | 24996 |
| 74 | Ga0466711_109279 | 3300042615 | Bacteria | 19924 |
| 75 | Ga0466711_241704 | 3300042615 | Bacteria | 15416 |
| 76 | Ga0466723_163959 | 3300042618 | Bacteria | 6684 |
| 77 | Ga0466723_168112 | 3300042618 | Bacteria | 13051 |
| 78 | Ga0466723_356267 | 3300042618 | Unclassified | 1298 |
| 79 | Ga0466726_112415 | 3300042619 | Bacteria | 5892 |
| 80 | Ga0466726_152432 | 3300042619 | Bacteria | 1502 |
| 81 | JGI24698J34947_10004679 | 3300002449 | Bacteria | 7467 |
| 82 | JGI24695J34938_10010169 | 3300002450 | Bacteria | 5179 |
| 83 | JGI24695J34938_10026540 | 3300002450 | Bacteria | 2751 |
| 84 | Ga0068305_10009083 | 3300005083 | Bacteria | 24469 |
| 85 | Ga0072941_1003019 | 3300005201 | Bacteria | 56162 |
| 86 | Ga0466700_138511 | 3300042600 | Bacteria | 1930 |
| 87 | Ga0466716_216310 | 3300042605 | Bacteria | 7023 |
| 88 | Ga0466719_415384 | 3300042606 | Bacteria | 85790 |
| 89 | Ga0466722_074790 | 3300042609 | Bacteria | 3045 |
| 90 | Ga0466722_086541 | 3300042609 | Bacteria | 17160 |
| 91 | Ga0264413_102941 | 3300024493 | Bacteria | 11135 |
| 92 | Ga0466693_072518 | 3300042592 | Bacteria | 23712 |
| 93 | Ga0466693_154668 | 3300042592 | Bacteria | 13103 |
| 94 | Ga0466691_070561 | 3300042593 | Bacteria | 5135 |
| 95 | Ga0466694_106364 | 3300042594 | Bacteria | 28135 |
| 96 | Ga0466699_026831 | 3300042597 | Bacteria | 36485 |
| 97 | Ga0123355_10028033 | 3300009826 | Bacteria | 9103 |
| 98 | Ga0466705_064004 | 3300042612 | Bacteria | 7889 |
| 99 | Ga0466735_036486 | 3300042624 | Bacteria | 8726 |
| 100 | Ga0466735_155991 | 3300042624 | Bacteria | 1751 |
| 101 | Ga0466703_204641 | 3300042636 | Bacteria | 7615 |
| 102 | Ga0466703_233915 | 3300042636 | Bacteria | 9924 |
| 103 | Ga0466727_159331 | 3300042655 | Bacteria | 10597 |
| 104 | Ga0466727_309437 | 3300042655 | Bacteria | 1993 |
| 105 | Ga0466712_180190 | 3300042614 | Bacteria | 3940 |
| 106 | Ga0466711_020557 | 3300042615 | Bacteria | 3394 |
| 107 | Ga0466723_009721 | 3300042618 | Bacteria | 10320 |
| 108 | Ga0466723_061062 | 3300042618 | Bacteria | 33737 |
| 109 | Ga0466723_210196 | 3300042618 | Bacteria | 26496 |
| 110 | Ga0466726_202470 | 3300042619 | Bacteria | 4962 |
| 111 | Ga0466728_107723 | 3300042620 | Bacteria | 5951 |
| 112 | 2227275235 | 2225789004 | Bacteria | 30275 |
| 113 | JGI24695J34938_10010818 | 3300002450 | Bacteria | 4960 |
| 114 | JGI24695J34938_10011125 | 3300002450 | Bacteria | 4870 |
| 115 | Ga0072941_1002825 | 3300005201 | Bacteria | 15179 |
| 116 | Ga0466706_257976 | 3300042599 | Bacteria | 1414 |
| 117 | Ga0466716_142743 | 3300042605 | Bacteria | 4446 |
| 118 | Ga0466698_238196 | 3300042610 | Bacteria | 2026 |
| 119 | Ga0466690_017336 | 3300042590 | Bacteria | 17990 |
| 120 | Ga0466690_058145 | 3300042590 | Bacteria | 11705 |
| 121 | Ga0466692_150321 | 3300042591 | Bacteria | 20950 |
| 122 | Ga0466691_144210 | 3300042593 | Bacteria | 21786 |
| 123 | Ga0466694_234651 | 3300042594 | Bacteria | 4369 |
| 124 | Ga0466699_183035 | 3300042597 | Bacteria | 8281 |
| 125 | Ga0123357_10155122 | 3300009784 | Bacteria | 2764 |
| 126 | Ga0123353_10265237 | 3300010167 | Bacteria | 2650 |
| 127 | Ga0123353_10298845 | 3300010167 | Bacteria | 2459 |
| 128 | Ga0466704_013220 | 3300042643 | Bacteria | 1906 |
| 129 | Ga0466704_043323 | 3300042643 | Bacteria | 77338 |
| 130 | Ga0466704_155751 | 3300042643 | Bacteria | 8597 |
| 131 | Ga0466708_199326 | 3300042652 | Bacteria | 19137 |
| 132 | Ga0466705_446474 | 3300042612 | Bacteria | 4027 |
| 133 | Ga0466712_035404 | 3300042614 | Bacteria | 6040 |
| 134 | Ga0466715_408367 | 3300042616 | Bacteria | 7322 |
| 135 | Ga0466723_099381 | 3300042618 | Bacteria | 45625 |
| 136 | JGI24695J34938_10000530 | 3300002450 | Bacteria | 36998 |
| 137 | JGI24695J34938_10011390 | 3300002450 | Bacteria | 4793 |
| 138 | Ga0068305_10173101 | 3300005083 | Bacteria | 35194 |
| 139 | Ga0466706_079176 | 3300042599 | Bacteria | 3830 |
| 140 | Ga0466706_183905 | 3300042599 | Bacteria | 1739 |
| 141 | Ga0466716_157736 | 3300042605 | Bacteria | 9074 |
| 142 | Ga0466719_379361 | 3300042606 | Bacteria | 4055 |
| 143 | Ga0466722_027912 | 3300042609 | Bacteria | 4986 |
| 144 | Ga0466722_039139 | 3300042609 | Bacteria | 12588 |
| 145 | Ga0466722_085585 | 3300042609 | Bacteria | 7945 |
| 146 | Ga0264413_102940 | 3300024493 | Bacteria | 12167 |
| 147 | Ga0466690_017936 | 3300042590 | Bacteria | 2885 |
| 148 | Ga0466691_129158 | 3300042593 | Bacteria | 30130 |
| 149 | Ga0466691_151842 | 3300042593 | Bacteria | 33363 |
| 150 | Ga0466696_083696 | 3300042596 | Bacteria | 32412 |
| 151 | Ga0466696_085777 | 3300042596 | Bacteria | 3560 |
| 152 | Ga0466699_367573 | 3300042597 | Bacteria | 1663 |
| 153 | Ga0466705_322930 | 3300042612 | Bacteria | 7670 |
| 154 | Ga0466729_274830 | 3300042621 | Bacteria | 1380 |
| 155 | Ga0466704_113543 | 3300042643 | Bacteria | 47006 |
| 156 | Ga0466709_095095 | 3300042648 | Bacteria | 5001 |
| 157 | Ga0466709_114673 | 3300042648 | Bacteria | 7884 |
| 158 | Ga0466709_215496 | 3300042648 | Bacteria | 24534 |
| 159 | Ga0466727_175662 | 3300042655 | Bacteria | 3282 |
| 160 | Ga0466711_101269 | 3300042615 | Bacteria | 28356 |
| 161 | Ga0466711_159384 | 3300042615 | Bacteria | 2056 |
| 162 | Ga0466715_040894 | 3300042616 | Bacteria | 2074 |
| 163 | Ga0466715_089361 | 3300042616 | Bacteria | 31079 |
| 164 | Ga0466715_272677 | 3300042616 | Bacteria | 29328 |
| 165 | Ga0466728_079468 | 3300042620 | Bacteria | 3229 |
| 166 | JGI24695J34938_10001223 | 3300002450 | Bacteria | 22689 |
| 167 | Ga0466720_198766 | 3300042607 | Bacteria | 2404 |
| 168 | Ga0466722_028055 | 3300042609 | Bacteria | 10046 |
| 169 | Ga0466722_060333 | 3300042609 | Bacteria | 1622 |
| 170 | Ga0466722_168771 | 3300042609 | Bacteria | 25360 |
| 171 | Ga0456237_0005529 | 3300041968 | Bacteria | 2001 |
| 172 | Ga0466690_340623 | 3300042590 | Bacteria | 1758 |
| 173 | Ga0466690_393245 | 3300042590 | Bacteria | 2550 |
| 174 | Ga0466692_097620 | 3300042591 | Bacteria | 9071 |
| 175 | Ga0466691_177969 | 3300042593 | Bacteria | 10739 |
| 176 | Ga0466696_347390 | 3300042596 | Bacteria | 2285 |
| 177 | Ga0123356_10013652 | 3300010049 | Bacteria | 7829 |
| 178 | Ga0466735_086184 | 3300042624 | Bacteria | 4694 |
| 179 | Ga0466702_241968 | 3300042635 | Bacteria | 34411 |
| 180 | Ga0466703_202645 | 3300042636 | Bacteria | 17600 |
| 181 | Ga0466704_161698 | 3300042643 | Unclassified | 3041 |
| 182 | Ga0466708_433927 | 3300042652 | Bacteria | 5109 |
| 183 | Ga0466705_409209 | 3300042612 | Bacteria | 3636 |
| 184 | Ga0466711_099015 | 3300042615 | Bacteria | 17568 |
| 185 | Ga0466711_271612 | 3300042615 | Bacteria | 10976 |
| 186 | Ga0466718_156100 | 3300042617 | Bacteria | 1534 |
| 187 | Ga0466723_074615 | 3300042618 | Bacteria | 11892 |
| 188 | Ga0466726_363129 | 3300042619 | Bacteria | 3538 |
| 189 | Ga0466726_483378 | 3300042619 | Bacteria | 6470 |
| 190 | Ga0466732_316863 | 3300042656 | Bacteria | 36287 |
| 191 | Ga0466716_440275 | 3300042605 | Bacteria | 11230 |
| 192 | Ga0466719_490371 | 3300042606 | Bacteria | 15034 |
| 193 | Ga0466720_187643 | 3300042607 | Bacteria | 3665 |
| 194 | Ga0466722_070979 | 3300042609 | Bacteria | 8396 |
| 195 | Ga0466722_141991 | 3300042609 | Bacteria | 3741 |
| 196 | Ga0456237_0000227 | 3300041968 | Bacteria | 8220 |
| 197 | Ga0456237_0003208 | 3300041968 | Unclassified | 2656 |
| 198 | Ga0466690_077175 | 3300042590 | Bacteria | 5023 |
| 199 | Ga0466693_155480 | 3300042592 | Bacteria | 2384 |
| 200 | Ga0123356_10000647 | 3300010049 | Bacteria | 38345 |
| 201 | Ga0123356_10014421 | 3300010049 | Bacteria | 7599 |
| 202 | Ga0123353_10011959 | 3300010167 | Bacteria | 12280 |
| 203 | Ga0123353_10385131 | 3300010167 | Bacteria | 2095 |
| 204 | Ga0466705_047043 | 3300042612 | Bacteria | 38569 |
| 205 | Ga0466705_278570 | 3300042612 | Bacteria | 3737 |
| 206 | Ga0466731_364655 | 3300042622 | Bacteria | 1610 |
| 207 | Ga0466735_094825 | 3300042624 | Bacteria | 2908 |
| 208 | Ga0466703_021914 | 3300042636 | Bacteria | 11318 |
| 209 | Ga0466704_004955 | 3300042643 | Bacteria | 6044 |
| 210 | Ga0466704_029582 | 3300042643 | Bacteria | 40583 |
| 211 | Ga0466704_286786 | 3300042643 | Bacteria | 4688 |
| 212 | Ga0466708_029443 | 3300042652 | Bacteria | 7255 |
| 213 | Ga0466705_521028 | 3300042612 | Bacteria | 5188 |
| 214 | Ga0466715_313981 | 3300042616 | Bacteria | 6933 |
| 215 | Ga0466723_045433 | 3300042618 | Bacteria | 14123 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.