Protein Family IF01161
Metagenome
Metatranscriptome
Isolate
499
Members
205
Samples
377
Scaffolds
121.92
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10000087|Ga0068305_1000008759
- Length
- 137 aa
- Sequence
- MLEIGVDYKKIVNMLQQESRCKVSDNTGAKEALIIRVLGGSGKKYAVLGDTIVVTIKTAISGGSMIKKGQITKAIVIRTKKKTRRKDGSYISFDDNACVLINPSGEMIGTRVFGPVARELRDKEYMKIISLAQEVL*
Sample Types
Isolate
24.4%
Metagenome
74.3%
MAG
0.0%
Metatranscriptome
1.2%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
19.7%
Unclassified
15.7%
Blattidae
8.1%
Kalotermitidae
7.1%
Cryptocercidae
6.1%
Apidae
4.5%
Blaberidae
4.5%
Elmidae
3.5%
Blattellidae
3.5%
Pseudophyllodromiidae
2.5%
Rhinotermitidae
2.0%
Culicidae
2.0%
Termopsidae
2.0%
Drosophilidae
2.0%
Formicidae
2.0%
Corydiidae
1.5%
Passalidae
1.5%
Anaplectidae
1.0%
Ectobiidae
1.0%
Nyctiboridae
1.0%
Scarabaeidae
0.5%
Cerambycidae
0.5%
Aphididae
0.5%
Aphelinidae
0.5%
Nephropidae
0.5%
Noctuidae
0.5%
Lamproblattidae
0.5%
Panorpidae
0.5%
Sarcophagidae
0.5%
Delphacidae
0.5%
Hodotermitidae
0.5%
Harpacticidae
0.5%
Tryonicidae
0.5%
Stratiomyidae
0.5%
Cambaridae
0.5%
Monophlebidae
0.5%
Armadillidiidae
0.5%
Taxonomy
Archaea
0
Bacteria
427
Eukaryota
0
Viruses
0
Unclassified
72
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2833034481 | Blattabacterium punctulatus CPUwf | Isolate | Cryptocercidae |
| 2 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 3 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 4 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 5 | 2806310970 | Mesoplasma florum MQ3 | Isolate | Unclassified |
| 6 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 7 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 8 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 17 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 18 | 3001995318 | Blattabacterium cuenoti DYAKIkur | Isolate | Blattellidae |
| 19 | 3002004631 | Blattabacterium cuenoti ANAPome | Isolate | Anaplectidae |
| 20 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 21 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 22 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 2833037493 | Blattabacterium punctulatus CPUsv | Isolate | Cryptocercidae |
| 27 | 2833042786 | Blattabacterium punctulatus CPUsm | Isolate | Cryptocercidae |
| 28 | 2833051446 | Blattabacterium punctulatus CPUml | Isolate | Cryptocercidae |
| 29 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 30 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 31 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 32 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 33 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 34 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 35 | 3002002099 | Blattabacterium cuenoti ECTONUhan | Isolate | Ectobiidae |
| 36 | 3002004002 | Blattabacterium cuenoti EUPOLsin | Isolate | Corydiidae |
| 37 | 3002006476 | Blattabacterium cuenoti GYNAcap | Isolate | Blaberidae |
| 38 | 3002032411 | Blattabacterium cuenoti POLYPHAGsp | Isolate | Corydiidae |
| 39 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 40 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 42 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 43 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 44 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 49 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 50 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 51 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 52 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 53 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 54 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 55 | 2561511101 | Mesoplasma grammopterae ATCC 49580 | Isolate | Cerambycidae |
| 56 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 57 | 2806310987 | Mesoplasma florum BARC 787 | Isolate | Unclassified |
| 58 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 59 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 60 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 61 | 3002026852 | Blattabacterium cuenoti BEYBkur | Isolate | Blattellidae |
| 62 | 3300003131 | Encarsia pergandiella symbiont microbial communities from Weslaco, Texas | Metagenome | Aphelinidae |
| 63 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 64 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 65 | 2833033875 | Blattabacterium punctulatus CPUpc | Isolate | Cryptocercidae |
| 66 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 67 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 68 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 69 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 70 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 71 | 2561511170 | Blattabacterium sp. (Blatta orientalis) Tarazona | Isolate | Unclassified |
| 72 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 73 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 74 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 75 | 3002005847 | Blattabacterium cuenoti ECTOBIsp | Isolate | Ectobiidae |
| 76 | 3002007740 | Blattabacterium cuenoti NYCTIBsp | Isolate | Nyctiboridae |
| 77 | 3002023891 | Blattabacterium cuenoti MEGALOsp | Isolate | Nyctiboridae |
| 78 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 79 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 80 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 81 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 82 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 83 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 84 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 85 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 86 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 87 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 88 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 89 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 90 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 91 | 2833030225 | Blattabacterium punctulatus CPUmp | Isolate | Cryptocercidae |
| 92 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 93 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 94 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 95 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 96 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 97 | 2843673047 | Spiroplasma alleghenense PLHS-1 | Isolate | Panorpidae |
| 98 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 99 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 100 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 101 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 102 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 103 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 104 | 3000336795 | Cardinium endosymbiont of Sogatella furcifera cSfur | Isolate | Delphacidae |
| 105 | 3002024525 | Blattabacterium cuenoti EPILAmay | Isolate | Blaberidae |
| 106 | 3002025727 | Blattabacterium cuenoti EUPHYsp | Isolate | Pseudophyllodromiidae |
| 107 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 108 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 109 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 110 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 111 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 112 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 113 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 114 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 115 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 116 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 117 | 3300021222 | Termite gut microbial communities from nest from French Guiana - FG16_17b_4 mRNA SA | Metatranscriptome | |
| 118 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 119 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 120 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 121 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 122 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 123 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 124 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 125 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 126 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 127 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 128 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 129 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 130 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 131 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 132 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 133 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 134 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 135 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 136 | 2021593000 | Sample 264 | Metagenome | Harpacticidae |
| 137 | 2820580397 | Unclassified Firmicutes Emb289P3bin133 | Isolate | Unclassified |
| 138 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 139 | 3001995955 | Blattabacterium cuenoti ANAPcal | Isolate | Anaplectidae |
| 140 | 3002008998 | Blattabacterium cuenoti PARCOBvir | Isolate | Blattellidae |
| 141 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 142 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 143 | 3002029927 | Blattabacterium cuenoti CHORISOsp | Isolate | Pseudophyllodromiidae |
| 144 | 3002031185 | Blattabacterium cuenoti OPISTHori | Isolate | Blaberidae |
| 145 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 146 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 147 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 148 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 149 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 150 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 151 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 152 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 153 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 154 | 2833033236 | Blattabacterium sp. CKYod | Isolate | Cryptocercidae |
| 155 | 2833047020 | Blattabacterium punctulatus CPUbt | Isolate | Cryptocercidae |
| 156 | 2833050843 | Blattabacterium punctulatus CPUmc | Isolate | Cryptocercidae |
| 157 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 158 | 2518645548 | Blattabacterium sp. (Blaberus giganteus) | Isolate | Blaberidae |
| 159 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 160 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 161 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 162 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 163 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 164 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 165 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 166 | 650716011 | Blattabacterium sp. Bge | Isolate | Blattellidae |
| 167 | 3002002726 | Blattabacterium cuenoti PARATEMsp | Isolate | Blattellidae |
| 168 | 3002027480 | Blattabacterium cuenoti SCHULTlam | Isolate | Unclassified |
| 169 | 3002031819 | Blattabacterium cuenoti SHELFORDIsp | Isolate | Pseudophyllodromiidae |
| 170 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 171 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 172 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 173 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 174 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 175 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 176 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 177 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 178 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 179 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 180 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 181 | 2833044002 | Blattabacterium punctulatus CPUbr | Isolate | Cryptocercidae |
| 182 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 183 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 184 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 185 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 186 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 187 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 188 | 2511231112 | Blattabacterium punctulatus Cpu | Isolate | Cryptocercidae |
| 189 | 2585427656 | Endosymbiont of Llaveia axin axin | Isolate | Monophlebidae |
| 190 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 191 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 192 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 193 | 8071415077 | Blattabacterium cuenoti MACROPArhi | Isolate | Blaberidae |
| 194 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 195 | 3002003370 | Blattabacterium cuenoti THEREAreg | Isolate | Corydiidae |
| 196 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 197 | 3002007112 | Blattabacterium cuenoti CYRTOsp | Isolate | Blaberidae |
| 198 | 3002008367 | Blattabacterium cuenoti PARANAUcir | Isolate | Blaberidae |
| 199 | 3002023256 | Blattabacterium cuenoti RHABDOBsp | Isolate | Blaberidae |
| 200 | 3002028747 | Blattabacterium cuenoti ESCALves | Isolate | Blattellidae |
| 201 | 3002030550 | Blattabacterium cuenoti NEOLAXmac | Isolate | Blaberidae |
| 202 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 203 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 204 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 205 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_222636 | 3300042612 | Bacteria | 3771 |
| 2 | Ga0466732_224020 | 3300042656 | Bacteria | 1458 |
| 3 | Ga0466733_021652 | 3300042659 | Bacteria | 2329 |
| 4 | Ga0223675_1001036 | 3300021237 | Bacteria | 1208 |
| 5 | Ga0466656_234659 | 3300042550 | Bacteria | 1140 |
| 6 | Ga0466657_367532 | 3300042582 | Unclassified | 1171 |
| 7 | Ga0466696_018380 | 3300042596 | Unclassified | 1351 |
| 8 | Ga0466696_235860 | 3300042596 | Unclassified | 11519 |
| 9 | Ga0466699_227137 | 3300042597 | Unclassified | 1483 |
| 10 | Ga0466710_039997 | 3300042613 | Bacteria | 3114 |
| 11 | Ga0466715_339223 | 3300042616 | Bacteria | 59419 |
| 12 | Ga0466715_471063 | 3300042616 | Bacteria | 22550 |
| 13 | Ga0466723_321837 | 3300042618 | Unclassified | 3814 |
| 14 | Ga0466726_097429 | 3300042619 | Bacteria | 22374 |
| 15 | IMNBL1DRAFT_c0076141 | 3300000062 | Bacteria | 952 |
| 16 | JGI24702J35022_10000547 | 3300002462 | Bacteria | 22726 |
| 17 | JGI24702J35022_10016196 | 3300002462 | Bacteria | 4089 |
| 18 | Ga0068302_10112254 | 3300005071 | Bacteria | 4311 |
| 19 | Ga0068305_10005585 | 3300005083 | Bacteria | 21211 |
| 20 | Ga0104019_1028430 | 3300007150 | Unclassified | 4280 |
| 21 | Ga0103267_1000029 | 3300007190 | Bacteria | 51888 |
| 22 | Ga0123355_10002018 | 3300009826 | Bacteria | 28705 |
| 23 | Ga0123355_10294189 | 3300009826 | Unclassified | 2223 |
| 24 | Ga0123355_10591243 | 3300009826 | Unclassified | 1322 |
| 25 | Ga0123356_10824572 | 3300010049 | Bacteria | 1099 |
| 26 | Ga0123356_12603393 | 3300010049 | Bacteria | 633 |
| 27 | Ga0123356_13780708 | 3300010049 | Unclassified | 523 |
| 28 | Ga0123353_10016319 | 3300010167 | Bacteria | 10850 |
| 29 | Ga0466731_015609 | 3300042622 | Bacteria | 1540 |
| 30 | Ga0466731_314406 | 3300042622 | Unclassified | 2378 |
| 31 | Ga0466734_033568 | 3300042623 | Unclassified | 1967 |
| 32 | Ga0466735_236210 | 3300042624 | Bacteria | 1055 |
| 33 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 34 | Ga0466730_084715 | 3300042625 | Bacteria | 2994 |
| 35 | Ga0466702_229598 | 3300042635 | Bacteria | 1647 |
| 36 | Ga0466704_035266 | 3300042643 | Bacteria | 32811 |
| 37 | Ga0466704_187124 | 3300042643 | Bacteria | 12261 |
| 38 | Ga0466709_170238 | 3300042648 | Bacteria | 55916 |
| 39 | Ga0466709_208437 | 3300042648 | Bacteria | 82349 |
| 40 | Ga0466709_406939 | 3300042648 | Bacteria | 144693 |
| 41 | Ga0466724_59228 | 3300042649 | Unclassified | 1992 |
| 42 | Ga0466725_213877 | 3300042654 | Bacteria | 2875 |
| 43 | Ga0466701_030730 | 3300042598 | Bacteria | 15256 |
| 44 | Ga0466700_345148 | 3300042600 | Bacteria | 1033 |
| 45 | Ga0466714_140510 | 3300042603 | Bacteria | 1287 |
| 46 | Ga0466717_090799 | 3300042604 | Bacteria | 1304 |
| 47 | Ga0466717_218016 | 3300042604 | Bacteria | 1118 |
| 48 | Ga0466722_058356 | 3300042609 | Bacteria | 4515 |
| 49 | Ga0466722_245127 | 3300042609 | Bacteria | 32663 |
| 50 | Ga0466698_439910 | 3300042610 | Bacteria | 1160 |
| 51 | Ga0466697_150762 | 3300042611 | Bacteria | 1109 |
| 52 | Ga0466727_352642 | 3300042655 | Bacteria | 45291 |
| 53 | Ga0466732_242870 | 3300042656 | Bacteria | 97652 |
| 54 | Ga0466733_068586 | 3300042659 | Bacteria | 1428 |
| 55 | Ga0466733_217362 | 3300042659 | Bacteria | 3716 |
| 56 | Ga0415639_046035 | 3300038395 | Bacteria | 4339 |
| 57 | Ga0466657_087898 | 3300042582 | Bacteria | 1087 |
| 58 | Ga0466657_203405 | 3300042582 | Bacteria | 6735 |
| 59 | Ga0466690_217090 | 3300042590 | Bacteria | 43815 |
| 60 | Ga0466695_394828 | 3300042595 | Bacteria | 6915 |
| 61 | Ga0466715_547764 | 3300042616 | Bacteria | 1840 |
| 62 | Ga0466718_119526 | 3300042617 | Bacteria | 1899 |
| 63 | Ga0466726_207501 | 3300042619 | Bacteria | 8201 |
| 64 | JGI24702J35022_10023308 | 3300002462 | Bacteria | 3347 |
| 65 | JGI24705J35276_11974027 | 3300002504 | Bacteria | 818 |
| 66 | JGI24705J35276_12214984 | 3300002504 | Bacteria | 1983 |
| 67 | Ga0068305_10170175 | 3300005083 | Bacteria | 2213 |
| 68 | Ga0102734_1000004 | 3300007129 | Bacteria | 74698 |
| 69 | Ga0123357_10054524 | 3300009784 | Bacteria | 5389 |
| 70 | Ga0123355_10001096 | 3300009826 | Bacteria | 37400 |
| 71 | Ga0123355_10003105 | 3300009826 | Bacteria | 23706 |
| 72 | Ga0123355_10021397 | 3300009826 | Bacteria | 10348 |
| 73 | Ga0123355_10062748 | 3300009826 | Bacteria | 5996 |
| 74 | Ga0123355_10157606 | 3300009826 | Bacteria | 3430 |
| 75 | Ga0123355_10241794 | 3300009826 | Bacteria | 2556 |
| 76 | Ga0123356_10073866 | 3300010049 | Bacteria | 3208 |
| 77 | Ga0123356_10191106 | 3300010049 | Unclassified | 2078 |
| 78 | Ga0123353_10361729 | 3300010167 | Bacteria | 2180 |
| 79 | Ga0466735_035569 | 3300042624 | Unclassified | 1455 |
| 80 | Ga0466709_143491 | 3300042648 | Unclassified | 1264 |
| 81 | Ga0466709_235305 | 3300042648 | Bacteria | 3321 |
| 82 | Ga0466725_457697 | 3300042654 | Unclassified | 1436 |
| 83 | Ga0466706_043865 | 3300042599 | Bacteria | 1081 |
| 84 | Ga0466707_026195 | 3300042601 | Bacteria | 1679 |
| 85 | Ga0466707_182798 | 3300042601 | Unclassified | 1046 |
| 86 | Ga0466707_351878 | 3300042601 | Bacteria | 23367 |
| 87 | Ga0466717_033155 | 3300042604 | Bacteria | 1231 |
| 88 | Ga0466697_139692 | 3300042611 | Bacteria | 246544 |
| 89 | Ga0466697_222388 | 3300042611 | Unclassified | 1530 |
| 90 | Ga0466697_271579 | 3300042611 | Bacteria | 1199 |
| 91 | Ga0466705_089766 | 3300042612 | Bacteria | 11993 |
| 92 | Ga0466705_244249 | 3300042612 | Unclassified | 3025 |
| 93 | Ga0466727_349423 | 3300042655 | Bacteria | 30219 |
| 94 | Ga0466733_013347 | 3300042659 | Bacteria | 6976 |
| 95 | Ga0466733_071083 | 3300042659 | Bacteria | 9797 |
| 96 | Ga0466733_188673 | 3300042659 | Unclassified | 7150 |
| 97 | Ga0255809_1023894 | 3300022820 | Bacteria | 1905 |
| 98 | Ga0415639_006543 | 3300038395 | Bacteria | 4682 |
| 99 | Ga0466656_013690 | 3300042550 | Unclassified | 1236 |
| 100 | Ga0466691_066359 | 3300042593 | Bacteria | 26336 |
| 101 | Ga0466694_387483 | 3300042594 | Bacteria | 1862 |
| 102 | Ga0466701_000611 | 3300042598 | Bacteria | 20652 |
| 103 | Ga0466711_120016 | 3300042615 | Bacteria | 45710 |
| 104 | Ga0466711_151287 | 3300042615 | Bacteria | 2979 |
| 105 | Ga0466715_367868 | 3300042616 | Bacteria | 44460 |
| 106 | Ga0466728_139914 | 3300042620 | Bacteria | 13626 |
| 107 | 2227474812 | 2225789004 | Bacteria | 895 |
| 108 | 2227491320 | 2225789004 | Bacteria | 4075 |
| 109 | JGI24703J35330_11748024 | 3300002501 | Unclassified | 9993 |
| 110 | Ga0102736_1000046 | 3300007052 | Bacteria | 35527 |
| 111 | Ga0104045_1075055 | 3300007085 | Bacteria | 2224 |
| 112 | Ga0123357_10234730 | 3300009784 | Bacteria | 2001 |
| 113 | Ga0123357_10360950 | 3300009784 | Bacteria | 1376 |
| 114 | Ga0123357_10423598 | 3300009784 | Bacteria | 1185 |
| 115 | Ga0123355_10102229 | 3300009826 | Bacteria | 4508 |
| 116 | Ga0123355_10254812 | 3300009826 | Bacteria | 2464 |
| 117 | Ga0123355_10294517 | 3300009826 | Bacteria | 2221 |
| 118 | Ga0123355_10445259 | 3300009826 | Bacteria | 1637 |
| 119 | Ga0123356_10020734 | 3300010049 | Bacteria | 6216 |
| 120 | Ga0123356_11111957 | 3300010049 | Bacteria | 958 |
| 121 | Ga0123356_11282278 | 3300010049 | Bacteria | 896 |
| 122 | Ga0123356_11749725 | 3300010049 | Bacteria | 772 |
| 123 | Ga0123356_12430692 | 3300010049 | Bacteria | 656 |
| 124 | Ga0123356_13289162 | 3300010049 | Bacteria | 562 |
| 125 | Ga0123353_10347257 | 3300010167 | Bacteria | 2238 |
| 126 | Ga0123353_10367522 | 3300010167 | Bacteria | 2158 |
| 127 | Ga0123354_10157620 | 3300010882 | Bacteria | 2714 |
| 128 | Ga0123354_10225873 | 3300010882 | Bacteria | 1973 |
| 129 | Ga0466734_090847 | 3300042623 | Bacteria | 1050 |
| 130 | Ga0466734_092518 | 3300042623 | Unclassified | 1877 |
| 131 | Ga0466734_158837 | 3300042623 | Bacteria | 1241 |
| 132 | Ga0466735_003438 | 3300042624 | Unclassified | 1321 |
| 133 | Ga0466735_232692 | 3300042624 | Bacteria | 20733 |
| 134 | Ga0466724_35568 | 3300042649 | Bacteria | 1100 |
| 135 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 136 | Ga0466708_207293 | 3300042652 | Bacteria | 33526 |
| 137 | Ga0466701_038995 | 3300042598 | Bacteria | 5162 |
| 138 | Ga0466701_071929 | 3300042598 | Bacteria | 1002 |
| 139 | Ga0466701_087824 | 3300042598 | Unclassified | 1005 |
| 140 | Ga0466700_005233 | 3300042600 | Bacteria | 1897 |
| 141 | Ga0466700_117494 | 3300042600 | Bacteria | 3532 |
| 142 | Ga0466700_362329 | 3300042600 | Bacteria | 1992 |
| 143 | Ga0466707_360699 | 3300042601 | Bacteria | 17316 |
| 144 | Ga0466713_002076 | 3300042602 | Bacteria | 1197 |
| 145 | Ga0466713_029225 | 3300042602 | Bacteria | 54762 |
| 146 | Ga0466716_348093 | 3300042605 | Bacteria | 2103 |
| 147 | Ga0466697_101147 | 3300042611 | Bacteria | 2146 |
| 148 | Ga0466733_220977 | 3300042659 | Bacteria | 23380 |
| 149 | Ga0223678_1012694 | 3300021222 | Bacteria | 637 |
| 150 | Ga0223674_1012164 | 3300021235 | Bacteria | 1385 |
| 151 | Ga0466657_371178 | 3300042582 | Bacteria | 21430 |
| 152 | Ga0466696_311317 | 3300042596 | Bacteria | 1146 |
| 153 | Ga0466696_398980 | 3300042596 | Bacteria | 15504 |
| 154 | Ga0466696_431999 | 3300042596 | Unclassified | 3391 |
| 155 | Ga0466711_110655 | 3300042615 | Unclassified | 1379 |
| 156 | Ga0466715_162043 | 3300042616 | Bacteria | 36555 |
| 157 | Ga0466723_374595 | 3300042618 | Bacteria | 26188 |
| 158 | Ga0466728_117422 | 3300042620 | Unclassified | 1416 |
| 159 | TM1208_contig24160 | 2021593000 | Bacteria | 1283 |
| 160 | 2227469069 | 2225789004 | Bacteria | 24169 |
| 161 | HBC_ctgsDRAFT_1000005 | 3300000333 | Bacteria | 62596 |
| 162 | JGI24695J34938_10000403 | 3300002450 | Bacteria | 42148 |
| 163 | JGI24700J35501_10920524 | 3300002508 | Bacteria | 4578 |
| 164 | JGI24700J35501_10930659 | 3300002508 | Bacteria | 17918 |
| 165 | JGI24696J40584_12942259 | 3300002834 | Bacteria | 1735 |
| 166 | JGI24696J40584_12954805 | 3300002834 | Bacteria | 2708 |
| 167 | Ga0068305_10401000 | 3300005083 | Bacteria | 1125 |
| 168 | Ga0104048_1024507 | 3300007143 | Bacteria | 1811 |
| 169 | Ga0123355_10167294 | 3300009826 | Unclassified | 3295 |
| 170 | Ga0123355_10425880 | 3300009826 | Bacteria | 1692 |
| 171 | Ga0123355_10723822 | 3300009826 | Bacteria | 1134 |
| 172 | Ga0123356_10107730 | 3300010049 | Bacteria | 2685 |
| 173 | Ga0123356_10202491 | 3300010049 | Bacteria | 2026 |
| 174 | Ga0123356_10556430 | 3300010049 | Bacteria | 1309 |
| 175 | Ga0123356_12404445 | 3300010049 | Bacteria | 659 |
| 176 | Ga0466731_116644 | 3300042622 | Bacteria | 2119 |
| 177 | Ga0466734_032908 | 3300042623 | Bacteria | 3160 |
| 178 | Ga0466734_044487 | 3300042623 | Unclassified | 1235 |
| 179 | Ga0466702_086008 | 3300042635 | Bacteria | 1203 |
| 180 | Ga0466703_228703 | 3300042636 | Bacteria | 2647 |
| 181 | Ga0466724_47751 | 3300042649 | Unclassified | 1896 |
| 182 | Ga0466708_215505 | 3300042652 | Bacteria | 16232 |
| 183 | Ga0466706_033787 | 3300042599 | Bacteria | 1504 |
| 184 | Ga0466706_110873 | 3300042599 | Bacteria | 3310 |
| 185 | Ga0466706_217326 | 3300042599 | Bacteria | 1136 |
| 186 | Ga0466717_147138 | 3300042604 | Unclassified | 1796 |
| 187 | Ga0466719_128944 | 3300042606 | Unclassified | 2664 |
| 188 | Ga0466719_424805 | 3300042606 | Bacteria | 1163 |
| 189 | Ga0466721_282664 | 3300042608 | Bacteria | 1259 |
| 190 | Ga0223677_1008620 | 3300021239 | Unclassified | 646 |
| 191 | Ga0466690_136026 | 3300042590 | Bacteria | 11620 |
| 192 | Ga0466690_136616 | 3300042590 | Bacteria | 29160 |
| 193 | Ga0466692_161873 | 3300042591 | Bacteria | 51547 |
| 194 | Ga0466693_273216 | 3300042592 | Unclassified | 1408 |
| 195 | Ga0466691_172951 | 3300042593 | Unclassified | 4788 |
| 196 | Ga0466694_299864 | 3300042594 | Unclassified | 1015 |
| 197 | Ga0466710_317979 | 3300042613 | Bacteria | 1689 |
| 198 | Ga0466711_051634 | 3300042615 | Bacteria | 4203 |
| 199 | Ga0466711_051724 | 3300042615 | Bacteria | 11431 |
| 200 | Ga0466711_373674 | 3300042615 | Bacteria | 10875 |
| 201 | Ga0466723_221261 | 3300042618 | Unclassified | 1541 |
| 202 | Ga0466723_315712 | 3300042618 | Bacteria | 6485 |
| 203 | Ga0466726_318285 | 3300042619 | Bacteria | 4319 |
| 204 | IMNBL1DRAFT_c0000219 | 3300000062 | Bacteria | 50195 |
| 205 | IMNBL1DRAFT_c0003268 | 3300000062 | Bacteria | 10563 |
| 206 | JGI24695J34938_10038127 | 3300002450 | Unclassified | 2179 |
| 207 | JGI24702J35022_10000685 | 3300002462 | Bacteria | 20647 |
| 208 | CVPL010W_10003963 | 3300002931 | Bacteria | 18555 |
| 209 | Ga0072940_1235491 | 3300005200 | Bacteria | 2637 |
| 210 | Ga0104044_1156045 | 3300007136 | Unclassified | 773 |
| 211 | Ga0127649_100060 | 3300009460 | Bacteria | 50841 |
| 212 | Ga0123357_10870410 | 3300009784 | Bacteria | 590 |
| 213 | Ga0123355_10080589 | 3300009826 | Bacteria | 5197 |
| 214 | Ga0123355_11752047 | 3300009826 | Unclassified | 589 |
| 215 | Ga0123355_11779369 | 3300009826 | Unclassified | 582 |
| 216 | Ga0123355_11802743 | 3300009826 | Unclassified | 577 |
| 217 | Ga0123356_11972080 | 3300010049 | Unclassified | 728 |
| 218 | Ga0123356_12367956 | 3300010049 | Unclassified | 664 |
| 219 | Ga0123353_10020258 | 3300010167 | Bacteria | 9926 |
| 220 | Ga0123353_11501636 | 3300010167 | Bacteria | 858 |
| 221 | Ga0123354_10082829 | 3300010882 | Bacteria | 4519 |
| 222 | Ga0466731_180586 | 3300042622 | Bacteria | 2122 |
| 223 | Ga0466735_044277 | 3300042624 | Bacteria | 4769 |
| 224 | Ga0466735_137998 | 3300042624 | Bacteria | 2582 |
| 225 | Ga0466735_207348 | 3300042624 | Bacteria | 2404 |
| 226 | Ga0466703_279649 | 3300042636 | Bacteria | 29017 |
| 227 | Ga0466703_369160 | 3300042636 | Bacteria | 28465 |
| 228 | Ga0466725_082702 | 3300042654 | Bacteria | 32093 |
| 229 | Ga0466725_380667 | 3300042654 | Bacteria | 5631 |
| 230 | Ga0466701_053809 | 3300042598 | Unclassified | 6003 |
| 231 | Ga0466706_206897 | 3300042599 | Bacteria | 23157 |
| 232 | Ga0466719_064833 | 3300042606 | Bacteria | 2202 |
| 233 | Ga0466719_253383 | 3300042606 | Unclassified | 1166 |
| 234 | Ga0466719_292822 | 3300042606 | Bacteria | 42754 |
| 235 | Ga0466721_239861 | 3300042608 | Bacteria | 2095 |
| 236 | Ga0466697_159381 | 3300042611 | Bacteria | 3322 |
| 237 | Ga0466733_062198 | 3300042659 | Bacteria | 1235 |
| 238 | Ga0466733_097212 | 3300042659 | Bacteria | 4274 |
| 239 | Ga0466656_195940 | 3300042550 | Bacteria | 1554 |
| 240 | Ga0466657_046516 | 3300042582 | Bacteria | 1861 |
| 241 | Ga0466657_087334 | 3300042582 | Bacteria | 3322 |
| 242 | Ga0466692_120097 | 3300042591 | Bacteria | 76506 |
| 243 | Ga0466696_367210 | 3300042596 | Bacteria | 9324 |
| 244 | Ga0466696_462270 | 3300042596 | Bacteria | 6201 |
| 245 | Ga0466701_004470 | 3300042598 | Bacteria | 1289 |
| 246 | Ga0466710_017949 | 3300042613 | Unclassified | 1634 |
| 247 | Ga0466710_181731 | 3300042613 | Bacteria | 1152 |
| 248 | Ga0466711_184685 | 3300042615 | Bacteria | 9250 |
| 249 | Ga0466728_071780 | 3300042620 | Bacteria | 4317 |
| 250 | 2227527393 | 2225789004 | Bacteria | 16791 |
| 251 | IMNBL1DRAFT_c0000311 | 3300000062 | Bacteria | 41422 |
| 252 | JGI24703J35330_11729498 | 3300002501 | Bacteria | 2663 |
| 253 | JGI24705J35276_12230458 | 3300002504 | Bacteria | 3635 |
| 254 | Ga0052165_100038 | 3300003131 | Bacteria | 11642 |
| 255 | Ga0068305_10015112 | 3300005083 | Bacteria | 28238 |
| 256 | Ga0072941_1219958 | 3300005201 | Bacteria | 2247 |
| 257 | Ga0104019_1005366 | 3300007150 | Bacteria | 3258 |
| 258 | Ga0123355_10365682 | 3300009826 | Unclassified | 1895 |
| 259 | Ga0123355_10368452 | 3300009826 | Unclassified | 1884 |
| 260 | Ga0123355_10779731 | 3300009826 | Unclassified | 1072 |
| 261 | Ga0123356_10007671 | 3300010049 | Bacteria | 10751 |
| 262 | Ga0123356_10441924 | 3300010049 | Bacteria | 1447 |
| 263 | Ga0123356_11552016 | 3300010049 | Unclassified | 818 |
| 264 | Ga0123353_10076527 | 3300010167 | Bacteria | 5377 |
| 265 | Ga0123353_10485327 | 3300010167 | Bacteria | 1806 |
| 266 | Ga0123353_11035068 | 3300010167 | Bacteria | 1099 |
| 267 | Ga0466731_316999 | 3300042622 | Bacteria | 1703 |
| 268 | Ga0466734_026297 | 3300042623 | Bacteria | 2489 |
| 269 | Ga0466735_221921 | 3300042624 | Bacteria | 30703 |
| 270 | Ga0466703_170258 | 3300042636 | Bacteria | 6143 |
| 271 | Ga0466709_152308 | 3300042648 | Bacteria | 15669 |
| 272 | Ga0466709_171547 | 3300042648 | Bacteria | 83571 |
| 273 | Ga0466706_190102 | 3300042599 | Bacteria | 1392 |
| 274 | Ga0466706_237340 | 3300042599 | Bacteria | 1712 |
| 275 | Ga0466706_266807 | 3300042599 | Bacteria | 4506 |
| 276 | Ga0466700_164676 | 3300042600 | Bacteria | 2894 |
| 277 | Ga0466713_127060 | 3300042602 | Bacteria | 78606 |
| 278 | Ga0466713_137499 | 3300042602 | Bacteria | 46639 |
| 279 | Ga0466717_099066 | 3300042604 | Bacteria | 1173 |
| 280 | Ga0466719_024981 | 3300042606 | Bacteria | 1202 |
| 281 | Ga0466698_248722 | 3300042610 | Bacteria | 1594 |
| 282 | Ga0466698_318539 | 3300042610 | Unclassified | 1939 |
| 283 | Ga0466733_043044 | 3300042659 | Bacteria | 3047 |
| 284 | Ga0466733_133583 | 3300042659 | Bacteria | 1928 |
| 285 | Ga0160456_106468 | 3300012820 | Unclassified | 1358 |
| 286 | Ga0466657_360416 | 3300042582 | Bacteria | 25893 |
| 287 | Ga0466692_185717 | 3300042591 | Unclassified | 1970 |
| 288 | Ga0466694_154793 | 3300042594 | Bacteria | 2093 |
| 289 | Ga0466695_119539 | 3300042595 | Bacteria | 1455 |
| 290 | Ga0466699_028911 | 3300042597 | Bacteria | 2429 |
| 291 | Ga0466710_445866 | 3300042613 | Bacteria | 4288 |
| 292 | Ga0466711_464836 | 3300042615 | Bacteria | 36759 |
| 293 | Ga0466726_406694 | 3300042619 | Bacteria | 19448 |
| 294 | JGI24702J35022_10015205 | 3300002462 | Bacteria | 4239 |
| 295 | JGI24702J35022_10098556 | 3300002462 | Bacteria | 1598 |
| 296 | JGI24699J35502_11084694 | 3300002509 | Bacteria | 2030 |
| 297 | JGI24696J40584_12858116 | 3300002834 | Unclassified | 1002 |
| 298 | Ga0123357_10473530 | 3300009784 | Bacteria | 1065 |
| 299 | Ga0123355_10001831 | 3300009826 | Bacteria | 29750 |
| 300 | Ga0123355_10024478 | 3300009826 | Bacteria | 9705 |
| 301 | Ga0123355_10144143 | 3300009826 | Bacteria | 3636 |
| 302 | Ga0123355_10195931 | 3300009826 | Bacteria | 2963 |
| 303 | Ga0123355_10347782 | 3300009826 | Bacteria | 1968 |
| 304 | Ga0123355_10384706 | 3300009826 | Unclassified | 1824 |
| 305 | Ga0123356_10118653 | 3300010049 | Bacteria | 2569 |
| 306 | Ga0123356_10250472 | 3300010049 | Bacteria | 1849 |
| 307 | Ga0123356_10429717 | 3300010049 | Bacteria | 1465 |
| 308 | Ga0123356_12853418 | 3300010049 | Bacteria | 604 |
| 309 | Ga0123353_11012372 | 3300010167 | Unclassified | 1115 |
| 310 | Ga0123353_11473668 | 3300010167 | Bacteria | 869 |
| 311 | Ga0123354_10150445 | 3300010882 | Bacteria | 2823 |
| 312 | Ga0123354_10294705 | 3300010882 | Unclassified | 1547 |
| 313 | Ga0123354_10554937 | 3300010882 | Unclassified | 864 |
| 314 | Ga0123354_10619544 | 3300010882 | Unclassified | 785 |
| 315 | Ga0123354_10826619 | 3300010882 | Unclassified | 619 |
| 316 | Ga0466735_086208 | 3300042624 | Bacteria | 2194 |
| 317 | Ga0466703_073446 | 3300042636 | Bacteria | 8423 |
| 318 | Ga0466703_288119 | 3300042636 | Bacteria | 1432 |
| 319 | Ga0466703_381858 | 3300042636 | Bacteria | 4954 |
| 320 | Ga0466708_135960 | 3300042652 | Bacteria | 21988 |
| 321 | Ga0466708_169565 | 3300042652 | Bacteria | 34312 |
| 322 | Ga0466725_292777 | 3300042654 | Unclassified | 1065 |
| 323 | Ga0466727_076044 | 3300042655 | Bacteria | 7582 |
| 324 | Ga0466706_039865 | 3300042599 | Bacteria | 18164 |
| 325 | Ga0466713_006906 | 3300042602 | Bacteria | 112453 |
| 326 | Ga0466713_072740 | 3300042602 | Bacteria | 29878 |
| 327 | Ga0466717_112943 | 3300042604 | Bacteria | 2764 |
| 328 | Ga0466716_335360 | 3300042605 | Bacteria | 11224 |
| 329 | Ga0466698_145828 | 3300042610 | Bacteria | 6446 |
| 330 | Ga0466698_431319 | 3300042610 | Unclassified | 1340 |
| 331 | Ga0466697_123350 | 3300042611 | Bacteria | 3594 |
| 332 | Ga0466733_085240 | 3300042659 | Bacteria | 1578 |
| 333 | Ga0466733_132938 | 3300042659 | Unclassified | 1144 |
| 334 | Ga0255809_1005350 | 3300022820 | Bacteria | 2286 |
| 335 | Ga0466656_318907 | 3300042550 | Bacteria | 1225 |
| 336 | Ga0466657_051535 | 3300042582 | Bacteria | 1823 |
| 337 | Ga0466657_369834 | 3300042582 | Bacteria | 7259 |
| 338 | Ga0466693_078533 | 3300042592 | Bacteria | 2944 |
| 339 | Ga0466691_195913 | 3300042593 | Unclassified | 1147 |
| 340 | Ga0466694_085488 | 3300042594 | Bacteria | 1138 |
| 341 | Ga0466696_210364 | 3300042596 | Bacteria | 6960 |
| 342 | Ga0466711_152703 | 3300042615 | Unclassified | 1845 |
| 343 | Ga0466726_037110 | 3300042619 | Bacteria | 18134 |
| 344 | Ga0466726_137556 | 3300042619 | Bacteria | 24871 |
| 345 | Ga0466726_350599 | 3300042619 | Bacteria | 1117 |
| 346 | Ga0466726_408314 | 3300042619 | Bacteria | 25305 |
| 347 | Ga0466729_024558 | 3300042621 | Bacteria | 9835 |
| 348 | Ga0466729_028580 | 3300042621 | Bacteria | 5717 |
| 349 | 2227065042 | 2225789003 | Unclassified | 706 |
| 350 | 2227414123 | 2225789004 | Bacteria | 26621 |
| 351 | 2227473799 | 2225789004 | Bacteria | 4746 |
| 352 | 2227629626 | 2225789004 | Bacteria | 2132 |
| 353 | JGI24696J40584_12889132 | 3300002834 | Bacteria | 1121 |
| 354 | Ga0068305_10000087 | 3300005083 | Bacteria | 586632 |
| 355 | Ga0123357_10282127 | 3300009784 | Bacteria | 1714 |
| 356 | Ga0123355_10003449 | 3300009826 | Bacteria | 22687 |
| 357 | Ga0123355_10246316 | 3300009826 | Unclassified | 2523 |
| 358 | Ga0123355_10734302 | 3300009826 | Unclassified | 1122 |
| 359 | Ga0123356_14072058 | 3300010049 | Unclassified | 503 |
| 360 | Ga0123353_10000175 | 3300010167 | Bacteria | 81609 |
| 361 | Ga0123353_10111084 | 3300010167 | Bacteria | 4415 |
| 362 | Ga0123353_10130009 | 3300010167 | Bacteria | 4042 |
| 363 | Ga0123353_10149725 | 3300010167 | Bacteria | 3727 |
| 364 | Ga0123353_11160268 | 3300010167 | Unclassified | 1018 |
| 365 | Ga0123353_12949762 | 3300010167 | Bacteria | 553 |
| 366 | Ga0123353_13405483 | 3300010167 | Bacteria | 504 |
| 367 | Ga0123354_10006670 | 3300010882 | Bacteria | 17209 |
| 368 | Ga0466708_097473 | 3300042652 | Bacteria | 40764 |
| 369 | Ga0466725_380104 | 3300042654 | Bacteria | 28941 |
| 370 | Ga0466727_331622 | 3300042655 | Bacteria | 5773 |
| 371 | Ga0466706_257675 | 3300042599 | Bacteria | 3305 |
| 372 | Ga0466714_137995 | 3300042603 | Bacteria | 1131 |
| 373 | Ga0466717_222055 | 3300042604 | Bacteria | 1365 |
| 374 | Ga0466716_532094 | 3300042605 | Bacteria | 21649 |
| 375 | Ga0466719_007556 | 3300042606 | Bacteria | 3364 |
| 376 | Ga0466722_037837 | 3300042609 | Bacteria | 1625 |
| 377 | Ga0466698_094276 | 3300042610 | Bacteria | 4974 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00238 | Ribosomal_L14 | Ribosomal protein L14p/L23e | 14 | 136 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.