Protein Family IF01161

Metagenome Metatranscriptome Isolate
499 Members
205 Samples
377 Scaffolds
121.92 Avg Length

🧬 Representative Sequence

ID
3300005083|Ga0068305_10000087|Ga0068305_1000008759
Length
137 aa
Sequence
MLEIGVDYKKIVNMLQQESRCKVSDNTGAKEALIIRVLGGSGKKYAVLGDTIVVTIKTAISGGSMIKKGQITKAIVIRTKKKTRRKDGSYISFDDNACVLINPSGEMIGTRVFGPVARELRDKEYMKIISLAQEVL*

πŸ“Š Sample Types

Isolate 24.4%
Metagenome 74.3%
MAG 0.0%
Metatranscriptome 1.2%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 19.7%
Unclassified 15.7%
Blattidae 8.1%
Kalotermitidae 7.1%
Cryptocercidae 6.1%
Apidae 4.5%
Blaberidae 4.5%
Elmidae 3.5%
Blattellidae 3.5%
Pseudophyllodromiidae 2.5%
Rhinotermitidae 2.0%
Culicidae 2.0%
Termopsidae 2.0%
Drosophilidae 2.0%
Formicidae 2.0%
Corydiidae 1.5%
Passalidae 1.5%
Anaplectidae 1.0%
Ectobiidae 1.0%
Nyctiboridae 1.0%
Scarabaeidae 0.5%
Cerambycidae 0.5%
Aphididae 0.5%
Aphelinidae 0.5%
Nephropidae 0.5%
Noctuidae 0.5%
Lamproblattidae 0.5%
Panorpidae 0.5%
Sarcophagidae 0.5%
Delphacidae 0.5%
Hodotermitidae 0.5%
Harpacticidae 0.5%
Tryonicidae 0.5%
Stratiomyidae 0.5%
Cambaridae 0.5%
Monophlebidae 0.5%
Armadillidiidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 427
Eukaryota 0
Viruses 0
Unclassified 72

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2833034481 Blattabacterium punctulatus CPUwf Isolate Cryptocercidae
2 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
3 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
4 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
5 2806310970 Mesoplasma florum MQ3 Isolate Unclassified
6 2820316744 Unclassified Firmicutes Nt197P3bin99 Isolate Unclassified
7 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
8 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
9 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
10 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
11 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
17 646311912 Blattabacterium sp. BPLAN Isolate Blattidae
18 3001995318 Blattabacterium cuenoti DYAKIkur Isolate Blattellidae
19 3002004631 Blattabacterium cuenoti ANAPome Isolate Anaplectidae
20 3002033046 Blattabacterium cuenoti ANALLAmet Isolate Blattellidae
21 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
22 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2833037493 Blattabacterium punctulatus CPUsv Isolate Cryptocercidae
27 2833042786 Blattabacterium punctulatus CPUsm Isolate Cryptocercidae
28 2833051446 Blattabacterium punctulatus CPUml Isolate Cryptocercidae
29 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
30 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
31 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
32 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
33 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
34 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
35 3002002099 Blattabacterium cuenoti ECTONUhan Isolate Ectobiidae
36 3002004002 Blattabacterium cuenoti EUPOLsin Isolate Corydiidae
37 3002006476 Blattabacterium cuenoti GYNAcap Isolate Blaberidae
38 3002032411 Blattabacterium cuenoti POLYPHAGsp Isolate Corydiidae
39 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
40 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
43 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
44 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 2832372155 Apibacter adventoris wkB301 Isolate Apidae
49 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
50 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
51 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
52 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
53 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
54 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
55 2561511101 Mesoplasma grammopterae ATCC 49580 Isolate Cerambycidae
56 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
57 2806310987 Mesoplasma florum BARC 787 Isolate Unclassified
58 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
59 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
60 2998929858 Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 Isolate Aphididae
61 3002026852 Blattabacterium cuenoti BEYBkur Isolate Blattellidae
62 3300003131 Encarsia pergandiella symbiont microbial communities from Weslaco, Texas Metagenome Aphelinidae
63 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
64 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
65 2833033875 Blattabacterium punctulatus CPUpc Isolate Cryptocercidae
66 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
67 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
68 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
69 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
70 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
71 2561511170 Blattabacterium sp. (Blatta orientalis) Tarazona Isolate Unclassified
72 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
73 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
74 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
75 3002005847 Blattabacterium cuenoti ECTOBIsp Isolate Ectobiidae
76 3002007740 Blattabacterium cuenoti NYCTIBsp Isolate Nyctiboridae
77 3002023891 Blattabacterium cuenoti MEGALOsp Isolate Nyctiboridae
78 3002028123 Blattabacterium cuenoti LAMPROsp Isolate Lamproblattidae
79 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
80 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
81 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
82 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
83 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
84 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
85 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
86 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
87 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
88 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
89 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
90 2832343623 Apibacter adventoris wkB180 Isolate Apidae
91 2833030225 Blattabacterium punctulatus CPUmp Isolate Cryptocercidae
92 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
93 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
94 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
95 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
96 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
97 2843673047 Spiroplasma alleghenense PLHS-1 Isolate Panorpidae
98 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
99 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
100 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
101 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
102 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
103 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
104 3000336795 Cardinium endosymbiont of Sogatella furcifera cSfur Isolate Delphacidae
105 3002024525 Blattabacterium cuenoti EPILAmay Isolate Blaberidae
106 3002025727 Blattabacterium cuenoti EUPHYsp Isolate Pseudophyllodromiidae
107 3002026254 Blattabacterium cuenoti BALTAsp Isolate Pseudophyllodromiidae
108 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
109 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
110 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
111 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
112 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
113 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
114 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
115 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
116 3300021237 Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA Metatranscriptome
117 3300021222 Termite gut microbial communities from nest from French Guiana - FG16_17b_4 mRNA SA Metatranscriptome
118 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
119 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
120 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
121 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
122 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
123 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
124 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
125 2832298047 Apibacter sp. wkB309 Isolate Apidae
126 2833043393 Blattabacterium clevelandi CCLhc Isolate Cryptocercidae
127 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
128 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
129 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
130 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
131 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
132 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
133 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
134 2820005795 Unclassified Synergistetes Nt197P3bin106 Isolate Unclassified
135 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
136 2021593000 Sample 264 Metagenome Harpacticidae
137 2820580397 Unclassified Firmicutes Emb289P3bin133 Isolate Unclassified
138 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
139 3001995955 Blattabacterium cuenoti ANAPcal Isolate Anaplectidae
140 3002008998 Blattabacterium cuenoti PARCOBvir Isolate Blattellidae
141 3002022645 Blattabacterium cuenoti TRYONIpar Isolate Tryonicidae
142 3002025161 Blattabacterium cuenoti MEDIASdel Isolate Pseudophyllodromiidae
143 3002029927 Blattabacterium cuenoti CHORISOsp Isolate Pseudophyllodromiidae
144 3002031185 Blattabacterium cuenoti OPISTHori Isolate Blaberidae
145 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
146 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
147 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
148 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
149 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
150 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
151 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
152 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
153 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
154 2833033236 Blattabacterium sp. CKYod Isolate Cryptocercidae
155 2833047020 Blattabacterium punctulatus CPUbt Isolate Cryptocercidae
156 2833050843 Blattabacterium punctulatus CPUmc Isolate Cryptocercidae
157 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
158 2518645548 Blattabacterium sp. (Blaberus giganteus) Isolate Blaberidae
159 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
160 2785510743 Apibacter sp. ESL0404 Isolate Apidae
161 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
162 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
163 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
164 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
165 641736255 Paenibacillus larvae larvae BRL-230010 Isolate Unclassified
166 650716011 Blattabacterium sp. Bge Isolate Blattellidae
167 3002002726 Blattabacterium cuenoti PARATEMsp Isolate Blattellidae
168 3002027480 Blattabacterium cuenoti SCHULTlam Isolate Unclassified
169 3002031819 Blattabacterium cuenoti SHELFORDIsp Isolate Pseudophyllodromiidae
170 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
171 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome
172 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
173 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
174 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
175 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
176 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
177 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
178 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
179 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
180 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
181 2833044002 Blattabacterium punctulatus CPUbr Isolate Cryptocercidae
182 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
183 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
184 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
185 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
186 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
187 2509276035 Saprospira grandis HR1, DSM 2844 Isolate
188 2511231112 Blattabacterium punctulatus Cpu Isolate Cryptocercidae
189 2585427656 Endosymbiont of Llaveia axin axin Isolate Monophlebidae
190 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
191 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
192 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
193 8071415077 Blattabacterium cuenoti MACROPArhi Isolate Blaberidae
194 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
195 3002003370 Blattabacterium cuenoti THEREAreg Isolate Corydiidae
196 3002005207 Blattabacterium cuenoti MELANOZsp Isolate Blattidae
197 3002007112 Blattabacterium cuenoti CYRTOsp Isolate Blaberidae
198 3002008367 Blattabacterium cuenoti PARANAUcir Isolate Blaberidae
199 3002023256 Blattabacterium cuenoti RHABDOBsp Isolate Blaberidae
200 3002028747 Blattabacterium cuenoti ESCALves Isolate Blattellidae
201 3002030550 Blattabacterium cuenoti NEOLAXmac Isolate Blaberidae
202 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
203 3300007136 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut Metagenome Drosophilidae
204 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
205 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_222636 3300042612 Bacteria 3771
2 Ga0466732_224020 3300042656 Bacteria 1458
3 Ga0466733_021652 3300042659 Bacteria 2329
4 Ga0223675_1001036 3300021237 Bacteria 1208
5 Ga0466656_234659 3300042550 Bacteria 1140
6 Ga0466657_367532 3300042582 Unclassified 1171
7 Ga0466696_018380 3300042596 Unclassified 1351
8 Ga0466696_235860 3300042596 Unclassified 11519
9 Ga0466699_227137 3300042597 Unclassified 1483
10 Ga0466710_039997 3300042613 Bacteria 3114
11 Ga0466715_339223 3300042616 Bacteria 59419
12 Ga0466715_471063 3300042616 Bacteria 22550
13 Ga0466723_321837 3300042618 Unclassified 3814
14 Ga0466726_097429 3300042619 Bacteria 22374
15 IMNBL1DRAFT_c0076141 3300000062 Bacteria 952
16 JGI24702J35022_10000547 3300002462 Bacteria 22726
17 JGI24702J35022_10016196 3300002462 Bacteria 4089
18 Ga0068302_10112254 3300005071 Bacteria 4311
19 Ga0068305_10005585 3300005083 Bacteria 21211
20 Ga0104019_1028430 3300007150 Unclassified 4280
21 Ga0103267_1000029 3300007190 Bacteria 51888
22 Ga0123355_10002018 3300009826 Bacteria 28705
23 Ga0123355_10294189 3300009826 Unclassified 2223
24 Ga0123355_10591243 3300009826 Unclassified 1322
25 Ga0123356_10824572 3300010049 Bacteria 1099
26 Ga0123356_12603393 3300010049 Bacteria 633
27 Ga0123356_13780708 3300010049 Unclassified 523
28 Ga0123353_10016319 3300010167 Bacteria 10850
29 Ga0466731_015609 3300042622 Bacteria 1540
30 Ga0466731_314406 3300042622 Unclassified 2378
31 Ga0466734_033568 3300042623 Unclassified 1967
32 Ga0466735_236210 3300042624 Bacteria 1055
33 Ga0466730_071786 3300042625 Bacteria 741189
34 Ga0466730_084715 3300042625 Bacteria 2994
35 Ga0466702_229598 3300042635 Bacteria 1647
36 Ga0466704_035266 3300042643 Bacteria 32811
37 Ga0466704_187124 3300042643 Bacteria 12261
38 Ga0466709_170238 3300042648 Bacteria 55916
39 Ga0466709_208437 3300042648 Bacteria 82349
40 Ga0466709_406939 3300042648 Bacteria 144693
41 Ga0466724_59228 3300042649 Unclassified 1992
42 Ga0466725_213877 3300042654 Bacteria 2875
43 Ga0466701_030730 3300042598 Bacteria 15256
44 Ga0466700_345148 3300042600 Bacteria 1033
45 Ga0466714_140510 3300042603 Bacteria 1287
46 Ga0466717_090799 3300042604 Bacteria 1304
47 Ga0466717_218016 3300042604 Bacteria 1118
48 Ga0466722_058356 3300042609 Bacteria 4515
49 Ga0466722_245127 3300042609 Bacteria 32663
50 Ga0466698_439910 3300042610 Bacteria 1160
51 Ga0466697_150762 3300042611 Bacteria 1109
52 Ga0466727_352642 3300042655 Bacteria 45291
53 Ga0466732_242870 3300042656 Bacteria 97652
54 Ga0466733_068586 3300042659 Bacteria 1428
55 Ga0466733_217362 3300042659 Bacteria 3716
56 Ga0415639_046035 3300038395 Bacteria 4339
57 Ga0466657_087898 3300042582 Bacteria 1087
58 Ga0466657_203405 3300042582 Bacteria 6735
59 Ga0466690_217090 3300042590 Bacteria 43815
60 Ga0466695_394828 3300042595 Bacteria 6915
61 Ga0466715_547764 3300042616 Bacteria 1840
62 Ga0466718_119526 3300042617 Bacteria 1899
63 Ga0466726_207501 3300042619 Bacteria 8201
64 JGI24702J35022_10023308 3300002462 Bacteria 3347
65 JGI24705J35276_11974027 3300002504 Bacteria 818
66 JGI24705J35276_12214984 3300002504 Bacteria 1983
67 Ga0068305_10170175 3300005083 Bacteria 2213
68 Ga0102734_1000004 3300007129 Bacteria 74698
69 Ga0123357_10054524 3300009784 Bacteria 5389
70 Ga0123355_10001096 3300009826 Bacteria 37400
71 Ga0123355_10003105 3300009826 Bacteria 23706
72 Ga0123355_10021397 3300009826 Bacteria 10348
73 Ga0123355_10062748 3300009826 Bacteria 5996
74 Ga0123355_10157606 3300009826 Bacteria 3430
75 Ga0123355_10241794 3300009826 Bacteria 2556
76 Ga0123356_10073866 3300010049 Bacteria 3208
77 Ga0123356_10191106 3300010049 Unclassified 2078
78 Ga0123353_10361729 3300010167 Bacteria 2180
79 Ga0466735_035569 3300042624 Unclassified 1455
80 Ga0466709_143491 3300042648 Unclassified 1264
81 Ga0466709_235305 3300042648 Bacteria 3321
82 Ga0466725_457697 3300042654 Unclassified 1436
83 Ga0466706_043865 3300042599 Bacteria 1081
84 Ga0466707_026195 3300042601 Bacteria 1679
85 Ga0466707_182798 3300042601 Unclassified 1046
86 Ga0466707_351878 3300042601 Bacteria 23367
87 Ga0466717_033155 3300042604 Bacteria 1231
88 Ga0466697_139692 3300042611 Bacteria 246544
89 Ga0466697_222388 3300042611 Unclassified 1530
90 Ga0466697_271579 3300042611 Bacteria 1199
91 Ga0466705_089766 3300042612 Bacteria 11993
92 Ga0466705_244249 3300042612 Unclassified 3025
93 Ga0466727_349423 3300042655 Bacteria 30219
94 Ga0466733_013347 3300042659 Bacteria 6976
95 Ga0466733_071083 3300042659 Bacteria 9797
96 Ga0466733_188673 3300042659 Unclassified 7150
97 Ga0255809_1023894 3300022820 Bacteria 1905
98 Ga0415639_006543 3300038395 Bacteria 4682
99 Ga0466656_013690 3300042550 Unclassified 1236
100 Ga0466691_066359 3300042593 Bacteria 26336
101 Ga0466694_387483 3300042594 Bacteria 1862
102 Ga0466701_000611 3300042598 Bacteria 20652
103 Ga0466711_120016 3300042615 Bacteria 45710
104 Ga0466711_151287 3300042615 Bacteria 2979
105 Ga0466715_367868 3300042616 Bacteria 44460
106 Ga0466728_139914 3300042620 Bacteria 13626
107 2227474812 2225789004 Bacteria 895
108 2227491320 2225789004 Bacteria 4075
109 JGI24703J35330_11748024 3300002501 Unclassified 9993
110 Ga0102736_1000046 3300007052 Bacteria 35527
111 Ga0104045_1075055 3300007085 Bacteria 2224
112 Ga0123357_10234730 3300009784 Bacteria 2001
113 Ga0123357_10360950 3300009784 Bacteria 1376
114 Ga0123357_10423598 3300009784 Bacteria 1185
115 Ga0123355_10102229 3300009826 Bacteria 4508
116 Ga0123355_10254812 3300009826 Bacteria 2464
117 Ga0123355_10294517 3300009826 Bacteria 2221
118 Ga0123355_10445259 3300009826 Bacteria 1637
119 Ga0123356_10020734 3300010049 Bacteria 6216
120 Ga0123356_11111957 3300010049 Bacteria 958
121 Ga0123356_11282278 3300010049 Bacteria 896
122 Ga0123356_11749725 3300010049 Bacteria 772
123 Ga0123356_12430692 3300010049 Bacteria 656
124 Ga0123356_13289162 3300010049 Bacteria 562
125 Ga0123353_10347257 3300010167 Bacteria 2238
126 Ga0123353_10367522 3300010167 Bacteria 2158
127 Ga0123354_10157620 3300010882 Bacteria 2714
128 Ga0123354_10225873 3300010882 Bacteria 1973
129 Ga0466734_090847 3300042623 Bacteria 1050
130 Ga0466734_092518 3300042623 Unclassified 1877
131 Ga0466734_158837 3300042623 Bacteria 1241
132 Ga0466735_003438 3300042624 Unclassified 1321
133 Ga0466735_232692 3300042624 Bacteria 20733
134 Ga0466724_35568 3300042649 Bacteria 1100
135 Ga0466724_59158 3300042649 Bacteria 434991
136 Ga0466708_207293 3300042652 Bacteria 33526
137 Ga0466701_038995 3300042598 Bacteria 5162
138 Ga0466701_071929 3300042598 Bacteria 1002
139 Ga0466701_087824 3300042598 Unclassified 1005
140 Ga0466700_005233 3300042600 Bacteria 1897
141 Ga0466700_117494 3300042600 Bacteria 3532
142 Ga0466700_362329 3300042600 Bacteria 1992
143 Ga0466707_360699 3300042601 Bacteria 17316
144 Ga0466713_002076 3300042602 Bacteria 1197
145 Ga0466713_029225 3300042602 Bacteria 54762
146 Ga0466716_348093 3300042605 Bacteria 2103
147 Ga0466697_101147 3300042611 Bacteria 2146
148 Ga0466733_220977 3300042659 Bacteria 23380
149 Ga0223678_1012694 3300021222 Bacteria 637
150 Ga0223674_1012164 3300021235 Bacteria 1385
151 Ga0466657_371178 3300042582 Bacteria 21430
152 Ga0466696_311317 3300042596 Bacteria 1146
153 Ga0466696_398980 3300042596 Bacteria 15504
154 Ga0466696_431999 3300042596 Unclassified 3391
155 Ga0466711_110655 3300042615 Unclassified 1379
156 Ga0466715_162043 3300042616 Bacteria 36555
157 Ga0466723_374595 3300042618 Bacteria 26188
158 Ga0466728_117422 3300042620 Unclassified 1416
159 TM1208_contig24160 2021593000 Bacteria 1283
160 2227469069 2225789004 Bacteria 24169
161 HBC_ctgsDRAFT_1000005 3300000333 Bacteria 62596
162 JGI24695J34938_10000403 3300002450 Bacteria 42148
163 JGI24700J35501_10920524 3300002508 Bacteria 4578
164 JGI24700J35501_10930659 3300002508 Bacteria 17918
165 JGI24696J40584_12942259 3300002834 Bacteria 1735
166 JGI24696J40584_12954805 3300002834 Bacteria 2708
167 Ga0068305_10401000 3300005083 Bacteria 1125
168 Ga0104048_1024507 3300007143 Bacteria 1811
169 Ga0123355_10167294 3300009826 Unclassified 3295
170 Ga0123355_10425880 3300009826 Bacteria 1692
171 Ga0123355_10723822 3300009826 Bacteria 1134
172 Ga0123356_10107730 3300010049 Bacteria 2685
173 Ga0123356_10202491 3300010049 Bacteria 2026
174 Ga0123356_10556430 3300010049 Bacteria 1309
175 Ga0123356_12404445 3300010049 Bacteria 659
176 Ga0466731_116644 3300042622 Bacteria 2119
177 Ga0466734_032908 3300042623 Bacteria 3160
178 Ga0466734_044487 3300042623 Unclassified 1235
179 Ga0466702_086008 3300042635 Bacteria 1203
180 Ga0466703_228703 3300042636 Bacteria 2647
181 Ga0466724_47751 3300042649 Unclassified 1896
182 Ga0466708_215505 3300042652 Bacteria 16232
183 Ga0466706_033787 3300042599 Bacteria 1504
184 Ga0466706_110873 3300042599 Bacteria 3310
185 Ga0466706_217326 3300042599 Bacteria 1136
186 Ga0466717_147138 3300042604 Unclassified 1796
187 Ga0466719_128944 3300042606 Unclassified 2664
188 Ga0466719_424805 3300042606 Bacteria 1163
189 Ga0466721_282664 3300042608 Bacteria 1259
190 Ga0223677_1008620 3300021239 Unclassified 646
191 Ga0466690_136026 3300042590 Bacteria 11620
192 Ga0466690_136616 3300042590 Bacteria 29160
193 Ga0466692_161873 3300042591 Bacteria 51547
194 Ga0466693_273216 3300042592 Unclassified 1408
195 Ga0466691_172951 3300042593 Unclassified 4788
196 Ga0466694_299864 3300042594 Unclassified 1015
197 Ga0466710_317979 3300042613 Bacteria 1689
198 Ga0466711_051634 3300042615 Bacteria 4203
199 Ga0466711_051724 3300042615 Bacteria 11431
200 Ga0466711_373674 3300042615 Bacteria 10875
201 Ga0466723_221261 3300042618 Unclassified 1541
202 Ga0466723_315712 3300042618 Bacteria 6485
203 Ga0466726_318285 3300042619 Bacteria 4319
204 IMNBL1DRAFT_c0000219 3300000062 Bacteria 50195
205 IMNBL1DRAFT_c0003268 3300000062 Bacteria 10563
206 JGI24695J34938_10038127 3300002450 Unclassified 2179
207 JGI24702J35022_10000685 3300002462 Bacteria 20647
208 CVPL010W_10003963 3300002931 Bacteria 18555
209 Ga0072940_1235491 3300005200 Bacteria 2637
210 Ga0104044_1156045 3300007136 Unclassified 773
211 Ga0127649_100060 3300009460 Bacteria 50841
212 Ga0123357_10870410 3300009784 Bacteria 590
213 Ga0123355_10080589 3300009826 Bacteria 5197
214 Ga0123355_11752047 3300009826 Unclassified 589
215 Ga0123355_11779369 3300009826 Unclassified 582
216 Ga0123355_11802743 3300009826 Unclassified 577
217 Ga0123356_11972080 3300010049 Unclassified 728
218 Ga0123356_12367956 3300010049 Unclassified 664
219 Ga0123353_10020258 3300010167 Bacteria 9926
220 Ga0123353_11501636 3300010167 Bacteria 858
221 Ga0123354_10082829 3300010882 Bacteria 4519
222 Ga0466731_180586 3300042622 Bacteria 2122
223 Ga0466735_044277 3300042624 Bacteria 4769
224 Ga0466735_137998 3300042624 Bacteria 2582
225 Ga0466735_207348 3300042624 Bacteria 2404
226 Ga0466703_279649 3300042636 Bacteria 29017
227 Ga0466703_369160 3300042636 Bacteria 28465
228 Ga0466725_082702 3300042654 Bacteria 32093
229 Ga0466725_380667 3300042654 Bacteria 5631
230 Ga0466701_053809 3300042598 Unclassified 6003
231 Ga0466706_206897 3300042599 Bacteria 23157
232 Ga0466719_064833 3300042606 Bacteria 2202
233 Ga0466719_253383 3300042606 Unclassified 1166
234 Ga0466719_292822 3300042606 Bacteria 42754
235 Ga0466721_239861 3300042608 Bacteria 2095
236 Ga0466697_159381 3300042611 Bacteria 3322
237 Ga0466733_062198 3300042659 Bacteria 1235
238 Ga0466733_097212 3300042659 Bacteria 4274
239 Ga0466656_195940 3300042550 Bacteria 1554
240 Ga0466657_046516 3300042582 Bacteria 1861
241 Ga0466657_087334 3300042582 Bacteria 3322
242 Ga0466692_120097 3300042591 Bacteria 76506
243 Ga0466696_367210 3300042596 Bacteria 9324
244 Ga0466696_462270 3300042596 Bacteria 6201
245 Ga0466701_004470 3300042598 Bacteria 1289
246 Ga0466710_017949 3300042613 Unclassified 1634
247 Ga0466710_181731 3300042613 Bacteria 1152
248 Ga0466711_184685 3300042615 Bacteria 9250
249 Ga0466728_071780 3300042620 Bacteria 4317
250 2227527393 2225789004 Bacteria 16791
251 IMNBL1DRAFT_c0000311 3300000062 Bacteria 41422
252 JGI24703J35330_11729498 3300002501 Bacteria 2663
253 JGI24705J35276_12230458 3300002504 Bacteria 3635
254 Ga0052165_100038 3300003131 Bacteria 11642
255 Ga0068305_10015112 3300005083 Bacteria 28238
256 Ga0072941_1219958 3300005201 Bacteria 2247
257 Ga0104019_1005366 3300007150 Bacteria 3258
258 Ga0123355_10365682 3300009826 Unclassified 1895
259 Ga0123355_10368452 3300009826 Unclassified 1884
260 Ga0123355_10779731 3300009826 Unclassified 1072
261 Ga0123356_10007671 3300010049 Bacteria 10751
262 Ga0123356_10441924 3300010049 Bacteria 1447
263 Ga0123356_11552016 3300010049 Unclassified 818
264 Ga0123353_10076527 3300010167 Bacteria 5377
265 Ga0123353_10485327 3300010167 Bacteria 1806
266 Ga0123353_11035068 3300010167 Bacteria 1099
267 Ga0466731_316999 3300042622 Bacteria 1703
268 Ga0466734_026297 3300042623 Bacteria 2489
269 Ga0466735_221921 3300042624 Bacteria 30703
270 Ga0466703_170258 3300042636 Bacteria 6143
271 Ga0466709_152308 3300042648 Bacteria 15669
272 Ga0466709_171547 3300042648 Bacteria 83571
273 Ga0466706_190102 3300042599 Bacteria 1392
274 Ga0466706_237340 3300042599 Bacteria 1712
275 Ga0466706_266807 3300042599 Bacteria 4506
276 Ga0466700_164676 3300042600 Bacteria 2894
277 Ga0466713_127060 3300042602 Bacteria 78606
278 Ga0466713_137499 3300042602 Bacteria 46639
279 Ga0466717_099066 3300042604 Bacteria 1173
280 Ga0466719_024981 3300042606 Bacteria 1202
281 Ga0466698_248722 3300042610 Bacteria 1594
282 Ga0466698_318539 3300042610 Unclassified 1939
283 Ga0466733_043044 3300042659 Bacteria 3047
284 Ga0466733_133583 3300042659 Bacteria 1928
285 Ga0160456_106468 3300012820 Unclassified 1358
286 Ga0466657_360416 3300042582 Bacteria 25893
287 Ga0466692_185717 3300042591 Unclassified 1970
288 Ga0466694_154793 3300042594 Bacteria 2093
289 Ga0466695_119539 3300042595 Bacteria 1455
290 Ga0466699_028911 3300042597 Bacteria 2429
291 Ga0466710_445866 3300042613 Bacteria 4288
292 Ga0466711_464836 3300042615 Bacteria 36759
293 Ga0466726_406694 3300042619 Bacteria 19448
294 JGI24702J35022_10015205 3300002462 Bacteria 4239
295 JGI24702J35022_10098556 3300002462 Bacteria 1598
296 JGI24699J35502_11084694 3300002509 Bacteria 2030
297 JGI24696J40584_12858116 3300002834 Unclassified 1002
298 Ga0123357_10473530 3300009784 Bacteria 1065
299 Ga0123355_10001831 3300009826 Bacteria 29750
300 Ga0123355_10024478 3300009826 Bacteria 9705
301 Ga0123355_10144143 3300009826 Bacteria 3636
302 Ga0123355_10195931 3300009826 Bacteria 2963
303 Ga0123355_10347782 3300009826 Bacteria 1968
304 Ga0123355_10384706 3300009826 Unclassified 1824
305 Ga0123356_10118653 3300010049 Bacteria 2569
306 Ga0123356_10250472 3300010049 Bacteria 1849
307 Ga0123356_10429717 3300010049 Bacteria 1465
308 Ga0123356_12853418 3300010049 Bacteria 604
309 Ga0123353_11012372 3300010167 Unclassified 1115
310 Ga0123353_11473668 3300010167 Bacteria 869
311 Ga0123354_10150445 3300010882 Bacteria 2823
312 Ga0123354_10294705 3300010882 Unclassified 1547
313 Ga0123354_10554937 3300010882 Unclassified 864
314 Ga0123354_10619544 3300010882 Unclassified 785
315 Ga0123354_10826619 3300010882 Unclassified 619
316 Ga0466735_086208 3300042624 Bacteria 2194
317 Ga0466703_073446 3300042636 Bacteria 8423
318 Ga0466703_288119 3300042636 Bacteria 1432
319 Ga0466703_381858 3300042636 Bacteria 4954
320 Ga0466708_135960 3300042652 Bacteria 21988
321 Ga0466708_169565 3300042652 Bacteria 34312
322 Ga0466725_292777 3300042654 Unclassified 1065
323 Ga0466727_076044 3300042655 Bacteria 7582
324 Ga0466706_039865 3300042599 Bacteria 18164
325 Ga0466713_006906 3300042602 Bacteria 112453
326 Ga0466713_072740 3300042602 Bacteria 29878
327 Ga0466717_112943 3300042604 Bacteria 2764
328 Ga0466716_335360 3300042605 Bacteria 11224
329 Ga0466698_145828 3300042610 Bacteria 6446
330 Ga0466698_431319 3300042610 Unclassified 1340
331 Ga0466697_123350 3300042611 Bacteria 3594
332 Ga0466733_085240 3300042659 Bacteria 1578
333 Ga0466733_132938 3300042659 Unclassified 1144
334 Ga0255809_1005350 3300022820 Bacteria 2286
335 Ga0466656_318907 3300042550 Bacteria 1225
336 Ga0466657_051535 3300042582 Bacteria 1823
337 Ga0466657_369834 3300042582 Bacteria 7259
338 Ga0466693_078533 3300042592 Bacteria 2944
339 Ga0466691_195913 3300042593 Unclassified 1147
340 Ga0466694_085488 3300042594 Bacteria 1138
341 Ga0466696_210364 3300042596 Bacteria 6960
342 Ga0466711_152703 3300042615 Unclassified 1845
343 Ga0466726_037110 3300042619 Bacteria 18134
344 Ga0466726_137556 3300042619 Bacteria 24871
345 Ga0466726_350599 3300042619 Bacteria 1117
346 Ga0466726_408314 3300042619 Bacteria 25305
347 Ga0466729_024558 3300042621 Bacteria 9835
348 Ga0466729_028580 3300042621 Bacteria 5717
349 2227065042 2225789003 Unclassified 706
350 2227414123 2225789004 Bacteria 26621
351 2227473799 2225789004 Bacteria 4746
352 2227629626 2225789004 Bacteria 2132
353 JGI24696J40584_12889132 3300002834 Bacteria 1121
354 Ga0068305_10000087 3300005083 Bacteria 586632
355 Ga0123357_10282127 3300009784 Bacteria 1714
356 Ga0123355_10003449 3300009826 Bacteria 22687
357 Ga0123355_10246316 3300009826 Unclassified 2523
358 Ga0123355_10734302 3300009826 Unclassified 1122
359 Ga0123356_14072058 3300010049 Unclassified 503
360 Ga0123353_10000175 3300010167 Bacteria 81609
361 Ga0123353_10111084 3300010167 Bacteria 4415
362 Ga0123353_10130009 3300010167 Bacteria 4042
363 Ga0123353_10149725 3300010167 Bacteria 3727
364 Ga0123353_11160268 3300010167 Unclassified 1018
365 Ga0123353_12949762 3300010167 Bacteria 553
366 Ga0123353_13405483 3300010167 Bacteria 504
367 Ga0123354_10006670 3300010882 Bacteria 17209
368 Ga0466708_097473 3300042652 Bacteria 40764
369 Ga0466725_380104 3300042654 Bacteria 28941
370 Ga0466727_331622 3300042655 Bacteria 5773
371 Ga0466706_257675 3300042599 Bacteria 3305
372 Ga0466714_137995 3300042603 Bacteria 1131
373 Ga0466717_222055 3300042604 Bacteria 1365
374 Ga0466716_532094 3300042605 Bacteria 21649
375 Ga0466719_007556 3300042606 Bacteria 3364
376 Ga0466722_037837 3300042609 Bacteria 1625
377 Ga0466698_094276 3300042610 Bacteria 4974

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00238 Ribosomal_L14 Ribosomal protein L14p/L23e 14 136 0.97

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.