Protein Family IF00956

Metagenome Isolate
203 Members
119 Samples
136 Scaffolds
208.37 Avg Length

🧬 Representative Sequence

ID
3300002931|CVPL010W_10002761|CVPL010W_1000276121
Length
236 aa
Sequence
MSDVIAMPPVFPAGAVASSAPGATAVISSPLPPATASSPALQFFSRKEHHPENGTALGFWLYLMSDCLIFACLFAVYAVVGRNYAAGPSGADLFDLNLVAVNTAMLLLSSITYGFAMLEVQRKRLRPAMVWLVVTGLFGAAFLGLELYEFAHLIHLGAVPQRSAFLSAFFTLVGTHGLHVTFGVIWLVTLLFQLNRHGLIPENRRRLMCLSMFWHFLDLIWIAVFTFVYLMGVLP*

📊 Sample Types

Isolate 33.0%
Metagenome 67.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 27.7%
Formicidae 17.0%
Elmidae 12.5%
Culicidae 10.7%
Armadillidiidae 7.1%
Termitidae 5.4%
Curculionidae 4.5%
Coreidae 3.6%
Hydrophilidae 1.8%
Aphididae 0.9%
Penaeidae 0.9%
Cerambycidae 0.9%
Crambidae 0.9%
Alydidae 0.9%
Muscidae 0.9%
Artemiidae 0.9%
Nephropidae 0.9%
Daphniidae 0.9%
Tenebrionidae 0.9%
Passalidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 160
Eukaryota 0
Viruses 0
Unclassified 43

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864951976 Brevundimonas bullata S00223 Isolate Elmidae
2 2511231129 Vibrio sp. EJY3 Isolate Unclassified
3 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
4 640963010 Vibrio harveyi HY01 Isolate Unclassified
5 8022345672 Vibrio sp. 070316B Isolate Unclassified
6 8100455565 Delftia sp. S67 Isolate Curculionidae
7 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
8 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
9 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
10 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
11 2864955722 Sphingomonas kyeonggiensis S00224 Isolate Elmidae
12 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
13 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
14 2603880165 Burkholderiales A1 Isolate Unclassified
15 2603880170 Burkholderiales A2 Isolate Unclassified
16 2603880172 Burkholderiales C Isolate Unclassified
17 8103008710 Erwinia sp. S43 Isolate Curculionidae
18 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
19 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
20 2838140227 Dyella sp. OAE510 Isolate Unclassified
21 2528768011 Serratia symbiotica SCt-VLC Isolate Aphididae
22 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
23 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
24 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
25 2791355473 Vibrio barjaei 3062 Isolate Unclassified
26 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
27 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
28 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
29 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
30 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
31 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
32 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
33 2864976888 Novosphingobium chloroacetimidivorans S00245 Isolate Elmidae
34 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
35 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
36 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
37 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
38 2648501628 Xanthomonas sp. Cag60 Isolate Unclassified
39 2684622551 Vibrio campbellii E1 Isolate Unclassified
40 8022096067 Vibrio sp. SALL6 Isolate Unclassified
41 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
42 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
43 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
44 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
45 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
46 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
47 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
48 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
49 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
50 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
51 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
52 2834230000 Pandoraea novymonadis E262 Isolate Unclassified
53 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
54 2864934081 Brevundimonas vesicularis S00192 Isolate Elmidae
55 2864993140 Agrobacterium vitis S00303 Isolate Elmidae
56 2912570088 Vibrio parahaemolyticus CHN25 Isolate
57 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
58 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
59 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
60 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
61 8100449422 Delftia sp. S66 Isolate Curculionidae
62 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
63 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
64 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
65 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
66 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
67 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
68 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
69 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
70 2864866972 Brevundimonas bullata S00123 Isolate Elmidae
71 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
72 2868169047 Comamonas aquatica S00077 Isolate Elmidae
73 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
74 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
75 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
76 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
77 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
78 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
79 8100461708 Delftia sp. S65 Isolate Curculionidae
80 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
81 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
82 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
83 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
84 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
85 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
86 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
87 2850895757 Vibrio campbellii 170502 Isolate Unclassified
88 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
89 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
90 2864937364 Acidovorax soli S00198 Isolate Elmidae
91 2873468275 Agrobacterium vitis S00131 Isolate Elmidae
92 2963630348 Burkholderiales bacterium 3487_49 Isolate Formicidae
93 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
94 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
95 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
96 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
97 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
98 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
99 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
100 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
101 2835143510 Yoonia maritima YPC211 Isolate Nephropidae
102 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
103 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
104 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
105 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
106 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
107 2556921669 Shinella sp. DD12 Isolate Daphniidae
108 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
109 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
110 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
111 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
112 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
113 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
114 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
115 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
116 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
117 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
118 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
119 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160469_100299 3300012824 Unclassified 31813
2 Ga0160455_100772 3300012837 Bacteria 12802
3 Ga0160472_100175 3300012839 Bacteria 85611
4 Ga0466730_064713 3300042625 Bacteria 1213
5 Ga0466724_16999 3300042649 Bacteria 89252
6 Ga0466724_27654 3300042649 Bacteria 76646
7 Ga0466701_023412 3300042598 Bacteria 70610
8 Ga0466701_068400 3300042598 Unclassified 2609
9 Ga0103263_101857 3300007042 Bacteria 2685
10 Ga0102735_1007267 3300007080 Unclassified 1402
11 Ga0103261_1002525 3300007083 Unclassified 4493
12 Ga0103264_1000222 3300007188 Bacteria 32373
13 Ga0123355_10806718 3300009826 Bacteria 1045
14 Ga0530661_000046 3300056564 Bacteria 137604
15 Ga0530661_101011 3300056564 Bacteria 816
16 Ga0160470_100531 3300012813 Bacteria 14980
17 Ga0160467_100024 3300012829 Bacteria 296626
18 Ga0160459_100067 3300012831 Bacteria 148681
19 Ga0160443_100071 3300012848 Bacteria 195428
20 AglaG_contig11637 2084038013 Bacteria 1109
21 CVPL010W_10032674 3300002931 Bacteria 1945
22 Ga0102736_1000652 3300007052 Unclassified 12088
23 Ga0103265_1001676 3300007068 Unclassified 3537
24 Ga0102735_1001315 3300007080 Bacteria 6213
25 Ga0102735_1007954 3300007080 Bacteria 1667
26 Ga0102740_1000173 3300007140 Unclassified 17992
27 Ga0103264_1000201 3300007188 Bacteria 34587
28 Ga0103264_1007316 3300007188 Bacteria 5328
29 Ga0160466_101559 3300012809 Bacteria 5942
30 Ga0160460_101214 3300012845 Bacteria 9627
31 Ga0160445_100598 3300012847 Bacteria 15747
32 Ga0160435_1006388 3300012857 Unclassified 2614
33 Ga0466730_051533 3300042625 Unclassified 11008
34 Ga0466701_029236 3300042598 Bacteria 3092
35 IMNBGM34_c000392 3300000036 Bacteria 12329
36 CVPL010W_10002761 3300002931 Bacteria 20482
37 CVPL010W_10005277 3300002931 Bacteria 13899
38 CVPL010W_10007756 3300002931 Unclassified 17155
39 CVPL010W_10027197 3300002931 Unclassified 2571
40 CVPL005W_1000305 3300002934 Unclassified 21237
41 Ga0102736_1004092 3300007052 Unclassified 2012
42 Ga0103261_1001169 3300007083 Unclassified 4187
43 Ga0103264_1000256 3300007188 Bacteria 30086
44 Ga0103264_1017613 3300007188 Unclassified 3493
45 Ga0103267_1000047 3300007190 Bacteria 52324
46 Ga0103268_1001808 3300007192 Bacteria 5037
47 Ga0103268_1002943 3300007192 Bacteria 3644
48 Ga0160433_100346 3300012846 Bacteria 27456
49 Ga0160434_100091 3300012850 Bacteria 55948
50 Ga0160430_110681 3300012852 Unclassified 1574
51 Ga0160435_1007120 3300012857 Bacteria 2451
52 Ga0466701_011549 3300042598 Unclassified 20904
53 Ga0466730_024232 3300042625 Bacteria 195834
54 Ga0466701_036301 3300042598 Bacteria 62814
55 Ga0466701_036414 3300042598 Bacteria 85852
56 Ga0063521_1002873 3300003973 Bacteria 4153
57 Ga0102737_1009663 3300007142 Unclassified 1651
58 Ga0103268_1000323 3300007192 Bacteria 15437
59 Ga0123355_10302052 3300009826 Bacteria 2181
60 Ga0123356_10112924 3300010049 Unclassified 2627
61 Ga0160441_100008 3300012825 Bacteria 515975
62 Ga0160467_100001 3300012829 Bacteria 1734829
63 Ga0160458_101159 3300012832 Bacteria 5890
64 Ga0160433_100047 3300012846 Bacteria 137821
65 Ga0160447_100443 3300012849 Bacteria 20265
66 Ga0160434_106569 3300012850 Bacteria 1917
67 Ga0160430_102920 3300012852 Bacteria 5070
68 Ga0103265_1010044 3300007068 Unclassified 1238
69 Ga0102739_1019636 3300007095 Unclassified 876
70 Ga0102734_1006234 3300007129 Bacteria 2667
71 Ga0102740_1000047 3300007140 Bacteria 35257
72 Ga0102740_1003300 3300007140 Unclassified 3495
73 Ga0102740_1005871 3300007140 Unclassified 2249
74 Ga0102740_1023790 3300007140 Unclassified 940
75 Ga0102737_1000817 3300007142 Bacteria 9620
76 Ga0102737_1000995 3300007142 Unclassified 8404
77 Ga0102737_1007516 3300007142 Unclassified 1983
78 Ga0103264_1000047 3300007188 Bacteria 127089
79 Ga0103264_1000860 3300007188 Bacteria 17626
80 Ga0103264_1007720 3300007188 Unclassified 5199
81 Ga0103268_1004156 3300007192 Bacteria 2955
82 Ga0160442_100006 3300012806 Bacteria 536179
83 Ga0160471_100398 3300012812 Bacteria 12844
84 Ga0160470_105005 3300012813 Bacteria 1751
85 Ga0160446_100045 3300012835 Bacteria 128446
86 Ga0160444_100399 3300012841 Bacteria 22384
87 Ga0160447_100007 3300012849 Bacteria 518930
88 CVPL010W_10011275 3300002931 Unclassified 7485
89 Ga0103263_100422 3300007042 Bacteria 5760
90 Ga0102736_1003273 3300007052 Unclassified 2876
91 Ga0102735_1000125 3300007080 Bacteria 39616
92 Ga0102739_1000908 3300007095 Unclassified 5209
93 Ga0102734_1000478 3300007129 Bacteria 16140
94 Ga0103260_1002531 3300007139 Bacteria 3070
95 Ga0160432_100045 3300012818 Unclassified 158320
96 Ga0160445_100004 3300012847 Bacteria 501773
97 Ga0160457_1000056 3300012858 Bacteria 180557
98 Ga0160436_1011787 3300012861 Bacteria 1863
99 Ga0466730_058063 3300042625 Bacteria 2902
100 Ga0466724_40346 3300042649 Bacteria 11379
101 CVPL010W_10000048 3300002931 Bacteria 72162
102 CVPL010W_10018781 3300002931 Bacteria 4260
103 CVPL005W_1000717 3300002934 Bacteria 19214
104 CVPL005L_10011940 3300002938 Unclassified 6613
105 Ga0102736_1000219 3300007052 Unclassified 13881
106 Ga0103266_1000031 3300007067 Bacteria 79302
107 Ga0103266_1000291 3300007067 Unclassified 12444
108 Ga0102735_1002992 3300007080 Unclassified 2440
109 Ga0103261_1001754 3300007083 Unclassified 3455
110 Ga0103261_1002822 3300007083 Bacteria 2725
111 Ga0103260_1000558 3300007139 Bacteria 7128
112 Ga0103260_1001985 3300007139 Unclassified 3545
113 Ga0102738_1000014 3300007141 Bacteria 90212
114 Ga0103264_1000186 3300007188 Bacteria 36758
115 Ga0103264_1000671 3300007188 Bacteria 16256
116 Ga0103268_1001533 3300007192 Bacteria 5679
117 Ga0160470_100194 3300012813 Bacteria 52711
118 Ga0160469_100063 3300012824 Bacteria 180671
119 Ga0160467_100368 3300012829 Bacteria 46976
120 Ga0160459_100296 3300012831 Unclassified 23186
121 Ga0160458_100009 3300012832 Bacteria 406372
122 Ga0160472_100579 3300012839 Bacteria 21101
123 Ga0160472_103715 3300012839 Unclassified 2912
124 Ga0160447_100141 3300012849 Bacteria 49585
125 Ga0160430_107708 3300012852 Bacteria 2122
126 Ga0160448_100174 3300012854 Bacteria 28576
127 Ga0160448_106831 3300012854 Bacteria 2800
128 CVPL010W_10009491 3300002931 Unclassified 12928
129 CVPL005W_1000155 3300002934 Unclassified 29395
130 Ga0102739_1008375 3300007095 Bacteria 1362
131 Ga0102737_1001468 3300007142 Bacteria 6540
132 Ga0102737_1005022 3300007142 Unclassified 2701
133 Ga0103264_1000582 3300007188 Unclassified 26958
134 Ga0103264_1001607 3300007188 Bacteria 10014
135 Ga0103268_1000025 3300007192 Bacteria 63089
136 Ga0160465_105485 3300012803 Bacteria 1635

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00510 COX3 Cytochrome c oxidase subunit III 52 232 0.86

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.