Protein Family IF00934
Metagenome
Isolate
223
Members
83
Samples
201
Scaffolds
95.74
Avg Length
Representative Sequence
- ID
- 3300002834|JGI24696J40584_12945178|JGI24696J40584_129451783
- Length
- 116 aa
- Sequence
- MFKELDPLLHSQLRLAVMSILISVEKADFVFLKEQTGATSGNLSVQIEKLKEAGYITIKKTFKGKMPRTVCSITQKGISAFEVYVQALQSYIGGKNRNIVAQENEKSARKDAFFV*
Sample Types
Isolate
9.9%
Metagenome
90.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.5%
Blattidae
18.3%
Kalotermitidae
15.9%
Unclassified
8.5%
Termopsidae
4.9%
Rhinotermitidae
3.7%
Passalidae
3.7%
Hydrophilidae
2.4%
Hodotermitidae
1.2%
Taxonomy
Archaea
0
Bacteria
207
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 2 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 3 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 4 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 7 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 8 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 27 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 32 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 33 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 41 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 42 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 46 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 47 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 48 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 49 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 50 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 51 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 52 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 53 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 55 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 56 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 57 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 58 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 59 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 60 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 61 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 62 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 63 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 64 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 65 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 66 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 67 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 68 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 69 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 70 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 71 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 72 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 73 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 74 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 75 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 76 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 77 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 78 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 79 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 80 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 81 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 82 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 83 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466731_117645 | 3300042622 | Bacteria | 1067 |
| 2 | Ga0466731_206223 | 3300042622 | Bacteria | 2327 |
| 3 | Ga0466734_138203 | 3300042623 | Bacteria | 1866 |
| 4 | Ga0466709_011830 | 3300042648 | Bacteria | 15152 |
| 5 | Ga0466708_195056 | 3300042652 | Bacteria | 18197 |
| 6 | Ga0466727_112583 | 3300042655 | Bacteria | 11437 |
| 7 | Ga0466727_217091 | 3300042655 | Bacteria | 6851 |
| 8 | Ga0466712_028627 | 3300042614 | Unclassified | 1939 |
| 9 | Ga0123357_10686821 | 3300009784 | Bacteria | 740 |
| 10 | Ga0123356_10608587 | 3300010049 | Unclassified | 1258 |
| 11 | Ga0123353_10335196 | 3300010167 | Bacteria | 2287 |
| 12 | IMNBL1DRAFT_c0000408 | 3300000062 | Bacteria | 36415 |
| 13 | IMNBL1DRAFT_c0000470 | 3300000062 | Bacteria | 33673 |
| 14 | JGI24705J35276_12179701 | 3300002504 | Unclassified | 1357 |
| 15 | JGI24699J35502_11132388 | 3300002509 | Bacteria | 6784 |
| 16 | Ga0466701_030955 | 3300042598 | Bacteria | 5316 |
| 17 | Ga0466706_289041 | 3300042599 | Bacteria | 4711 |
| 18 | Ga0466700_246317 | 3300042600 | Bacteria | 4520 |
| 19 | Ga0466713_136929 | 3300042602 | Bacteria | 2621 |
| 20 | Ga0466714_111374 | 3300042603 | Bacteria | 57741 |
| 21 | Ga0466721_120147 | 3300042608 | Bacteria | 2200 |
| 22 | Ga0466693_206721 | 3300042592 | Unclassified | 1812 |
| 23 | Ga0466691_083837 | 3300042593 | Bacteria | 11271 |
| 24 | Ga0466696_186765 | 3300042596 | Bacteria | 1384 |
| 25 | Ga0466733_137198 | 3300042659 | Bacteria | 51036 |
| 26 | Ga0466735_074050 | 3300042624 | Bacteria | 1571 |
| 27 | Ga0466730_097985 | 3300042625 | Bacteria | 2015 |
| 28 | Ga0466708_150749 | 3300042652 | Bacteria | 1618 |
| 29 | Ga0466725_233808 | 3300042654 | Bacteria | 11356 |
| 30 | Ga0466725_287835 | 3300042654 | Bacteria | 4856 |
| 31 | Ga0466710_422115 | 3300042613 | Bacteria | 1090 |
| 32 | Ga0466723_187832 | 3300042618 | Bacteria | 11485 |
| 33 | Ga0466726_028771 | 3300042619 | Bacteria | 4057 |
| 34 | Ga0123356_10051545 | 3300010049 | Bacteria | 3827 |
| 35 | Ga0123356_10510591 | 3300010049 | Bacteria | 1359 |
| 36 | Ga0123353_10008744 | 3300010167 | Bacteria | 13871 |
| 37 | Ga0123353_10060210 | 3300010167 | Bacteria | 6089 |
| 38 | Ga0123353_12087513 | 3300010167 | Unclassified | 690 |
| 39 | 2227088867 | 2225789004 | Bacteria | 1844 |
| 40 | IMNBL1DRAFT_c0008651 | 3300000062 | Bacteria | 5155 |
| 41 | JGI24696J40584_12550564 | 3300002834 | Bacteria | 626 |
| 42 | JGI24696J40584_12824840 | 3300002834 | Bacteria | 916 |
| 43 | JGI24696J40584_12945178 | 3300002834 | Bacteria | 1841 |
| 44 | Ga0466706_256437 | 3300042599 | Bacteria | 2816 |
| 45 | Ga0466717_001466 | 3300042604 | Bacteria | 3062 |
| 46 | Ga0466717_169348 | 3300042604 | Bacteria | 4062 |
| 47 | Ga0466719_105401 | 3300042606 | Bacteria | 1109 |
| 48 | Ga0466720_016029 | 3300042607 | Bacteria | 1460 |
| 49 | Ga0466656_043517 | 3300042550 | Bacteria | 1473 |
| 50 | Ga0466657_188835 | 3300042582 | Bacteria | 5859 |
| 51 | Ga0466692_046037 | 3300042591 | Bacteria | 15679 |
| 52 | Ga0466691_067538 | 3300042593 | Bacteria | 46176 |
| 53 | Ga0466691_167745 | 3300042593 | Bacteria | 4999 |
| 54 | Ga0466694_052130 | 3300042594 | Bacteria | 23069 |
| 55 | Ga0466694_064798 | 3300042594 | Unclassified | 2473 |
| 56 | Ga0466699_076901 | 3300042597 | Bacteria | 2657 |
| 57 | Ga0466697_184548 | 3300042611 | Bacteria | 2829 |
| 58 | Ga0466732_346881 | 3300042656 | Bacteria | 8720 |
| 59 | Ga0466733_012935 | 3300042659 | Bacteria | 50823 |
| 60 | Ga0466733_072440 | 3300042659 | Bacteria | 5411 |
| 61 | Ga0466731_387637 | 3300042622 | Bacteria | 1489 |
| 62 | Ga0466735_115307 | 3300042624 | Bacteria | 1075 |
| 63 | Ga0466702_354935 | 3300042635 | Bacteria | 1776 |
| 64 | Ga0466727_278238 | 3300042655 | Bacteria | 5291 |
| 65 | Ga0466711_015846 | 3300042615 | Bacteria | 2063 |
| 66 | Ga0466715_122714 | 3300042616 | Bacteria | 16938 |
| 67 | Ga0123356_10009526 | 3300010049 | Bacteria | 9591 |
| 68 | Ga0123356_11184619 | 3300010049 | Bacteria | 930 |
| 69 | Ga0123356_12200451 | 3300010049 | Bacteria | 689 |
| 70 | Ga0123353_11153495 | 3300010167 | Bacteria | 1022 |
| 71 | Ga0123354_10087930 | 3300010882 | Bacteria | 4327 |
| 72 | JGI24705J35276_12146560 | 3300002504 | Unclassified | 1164 |
| 73 | JGI24699J35502_11134124 | 3300002509 | Bacteria | 34130 |
| 74 | Ga0466701_057204 | 3300042598 | Bacteria | 1174 |
| 75 | Ga0466706_067361 | 3300042599 | Bacteria | 1484 |
| 76 | Ga0466707_084220 | 3300042601 | Bacteria | 6648 |
| 77 | Ga0466707_271194 | 3300042601 | Bacteria | 8475 |
| 78 | Ga0466707_290154 | 3300042601 | Bacteria | 4394 |
| 79 | Ga0466707_349020 | 3300042601 | Bacteria | 1510 |
| 80 | Ga0466713_082061 | 3300042602 | Bacteria | 2796 |
| 81 | Ga0466713_144989 | 3300042602 | Bacteria | 26601 |
| 82 | Ga0466714_073139 | 3300042603 | Bacteria | 1265 |
| 83 | Ga0466694_026562 | 3300042594 | Bacteria | 1106 |
| 84 | Ga0466696_289235 | 3300042596 | Bacteria | 13008 |
| 85 | Ga0466733_213799 | 3300042659 | Bacteria | 5228 |
| 86 | Ga0466735_171650 | 3300042624 | Bacteria | 3651 |
| 87 | Ga0466718_051941 | 3300042617 | Bacteria | 1239 |
| 88 | Ga0466726_150326 | 3300042619 | Bacteria | 1701 |
| 89 | Ga0123356_11374397 | 3300010049 | Unclassified | 867 |
| 90 | Ga0123354_10346086 | 3300010882 | Bacteria | 1333 |
| 91 | 2227386368 | 2225789004 | Bacteria | 5902 |
| 92 | IMNBL1DRAFT_c0000112 | 3300000062 | Bacteria | 72967 |
| 93 | JGI24702J35022_10024272 | 3300002462 | Bacteria | 3276 |
| 94 | JGI24702J35022_10042023 | 3300002462 | Bacteria | 2436 |
| 95 | Ga0072941_1296035 | 3300005201 | Bacteria | 551 |
| 96 | Ga0466701_097610 | 3300042598 | Bacteria | 8051 |
| 97 | Ga0466706_241450 | 3300042599 | Bacteria | 28578 |
| 98 | Ga0466713_147325 | 3300042602 | Bacteria | 11615 |
| 99 | Ga0466714_047740 | 3300042603 | Bacteria | 5122 |
| 100 | Ga0466717_050712 | 3300042604 | Bacteria | 1298 |
| 101 | Ga0466717_272150 | 3300042604 | Bacteria | 1494 |
| 102 | Ga0466693_351181 | 3300042592 | Bacteria | 1622 |
| 103 | Ga0466694_091247 | 3300042594 | Bacteria | 7198 |
| 104 | Ga0466694_312369 | 3300042594 | Bacteria | 3451 |
| 105 | Ga0466696_033053 | 3300042596 | Bacteria | 7600 |
| 106 | Ga0466696_388615 | 3300042596 | Bacteria | 11058 |
| 107 | Ga0466733_043813 | 3300042659 | Bacteria | 1738 |
| 108 | Ga0466735_074527 | 3300042624 | Bacteria | 4658 |
| 109 | Ga0466704_076130 | 3300042643 | Bacteria | 2217 |
| 110 | Ga0466727_268583 | 3300042655 | Bacteria | 10553 |
| 111 | Ga0466715_108887 | 3300042616 | Bacteria | 1101 |
| 112 | Ga0123356_13608852 | 3300010049 | Bacteria | 536 |
| 113 | Ga0123353_12329004 | 3300010167 | Bacteria | 643 |
| 114 | Ga0123354_11022502 | 3300010882 | Bacteria | 530 |
| 115 | IMNBL1DRAFT_c0007789 | 3300000062 | Bacteria | 5561 |
| 116 | JGI24702J35022_10174360 | 3300002462 | Unclassified | 1218 |
| 117 | JGI24696J40584_12700255 | 3300002834 | Unclassified | 737 |
| 118 | JGI24696J40584_12938450 | 3300002834 | Bacteria | 1628 |
| 119 | Ga0466701_018533 | 3300042598 | Bacteria | 2927 |
| 120 | Ga0466714_010307 | 3300042603 | Bacteria | 3947 |
| 121 | Ga0466714_111949 | 3300042603 | Bacteria | 3032 |
| 122 | Ga0466697_028794 | 3300042611 | Bacteria | 1765 |
| 123 | Ga0466657_231699 | 3300042582 | Bacteria | 1096 |
| 124 | Ga0466690_395317 | 3300042590 | Bacteria | 9106 |
| 125 | Ga0466694_007648 | 3300042594 | Bacteria | 1801 |
| 126 | Ga0466699_102411 | 3300042597 | Bacteria | 1336 |
| 127 | Ga0466701_011890 | 3300042598 | Bacteria | 1143 |
| 128 | Ga0466733_113919 | 3300042659 | Bacteria | 25761 |
| 129 | Ga0466704_251070 | 3300042643 | Bacteria | 5829 |
| 130 | Ga0466712_093820 | 3300042614 | Bacteria | 1364 |
| 131 | Ga0466711_261363 | 3300042615 | Bacteria | 7742 |
| 132 | Ga0466728_384727 | 3300042620 | Bacteria | 5306 |
| 133 | Ga0466728_484491 | 3300042620 | Bacteria | 7662 |
| 134 | Ga0123357_10733950 | 3300009784 | Unclassified | 694 |
| 135 | Ga0123356_10142312 | 3300010049 | Bacteria | 2367 |
| 136 | Ga0123353_10295972 | 3300010167 | Unclassified | 2474 |
| 137 | Ga0123353_10980292 | 3300010167 | Bacteria | 1139 |
| 138 | IMNBL1DRAFT_c0124338 | 3300000062 | Bacteria | 676 |
| 139 | Ga0068305_10127530 | 3300005083 | Bacteria | 7831 |
| 140 | Ga0466706_240395 | 3300042599 | Bacteria | 34677 |
| 141 | Ga0466720_218131 | 3300042607 | Unclassified | 1903 |
| 142 | Ga0466722_146473 | 3300042609 | Bacteria | 1479 |
| 143 | Ga0466656_271502 | 3300042550 | Bacteria | 1105 |
| 144 | Ga0466733_073456 | 3300042659 | Bacteria | 1181 |
| 145 | Ga0466731_016663 | 3300042622 | Bacteria | 2013 |
| 146 | Ga0466734_009577 | 3300042623 | Bacteria | 1271 |
| 147 | Ga0466735_015427 | 3300042624 | Bacteria | 1312 |
| 148 | Ga0466735_083586 | 3300042624 | Bacteria | 1394 |
| 149 | Ga0466735_228212 | 3300042624 | Bacteria | 1347 |
| 150 | Ga0466703_182845 | 3300042636 | Bacteria | 5143 |
| 151 | Ga0466727_060074 | 3300042655 | Bacteria | 2524 |
| 152 | Ga0123355_11612648 | 3300009826 | Bacteria | 624 |
| 153 | Ga0123356_11369074 | 3300010049 | Bacteria | 869 |
| 154 | Ga0123353_10597830 | 3300010167 | Unclassified | 1578 |
| 155 | Ga0123353_10897071 | 3300010167 | Unclassified | 1207 |
| 156 | 2227480171 | 2225789004 | Bacteria | 93917 |
| 157 | IMNBL1DRAFT_c0106611 | 3300000062 | Bacteria | 748 |
| 158 | JGI24698J34947_10188995 | 3300002449 | Unclassified | 816 |
| 159 | JGI24695J34938_10545457 | 3300002450 | Bacteria | 535 |
| 160 | JGI24702J35022_10477478 | 3300002462 | Bacteria | 762 |
| 161 | JGI24705J35276_11994108 | 3300002504 | Bacteria | 840 |
| 162 | JGI24705J35276_12134593 | 3300002504 | Bacteria | 1117 |
| 163 | JGI24696J40584_12726828 | 3300002834 | Bacteria | 765 |
| 164 | JGI24696J40584_12770146 | 3300002834 | Bacteria | 820 |
| 165 | Ga0068302_10062478 | 3300005071 | Bacteria | 5302 |
| 166 | Ga0068305_10038577 | 3300005083 | Bacteria | 2483 |
| 167 | Ga0466701_060487 | 3300042598 | Bacteria | 1239 |
| 168 | Ga0466713_059190 | 3300042602 | Bacteria | 3513 |
| 169 | Ga0466713_122827 | 3300042602 | Bacteria | 174567 |
| 170 | Ga0466722_101973 | 3300042609 | Bacteria | 15653 |
| 171 | Ga0466722_138230 | 3300042609 | Bacteria | 4904 |
| 172 | Ga0466690_188953 | 3300042590 | Bacteria | 22239 |
| 173 | Ga0466693_054073 | 3300042592 | Bacteria | 1235 |
| 174 | Ga0466695_130174 | 3300042595 | Bacteria | 2011 |
| 175 | Ga0466696_506704 | 3300042596 | Bacteria | 10502 |
| 176 | Ga0466697_119819 | 3300042611 | Bacteria | 3044 |
| 177 | Ga0466697_260209 | 3300042611 | Bacteria | 1207 |
| 178 | Ga0466705_381587 | 3300042612 | Bacteria | 1766 |
| 179 | Ga0466732_321983 | 3300042656 | Bacteria | 1030 |
| 180 | Ga0466735_163649 | 3300042624 | Bacteria | 1158 |
| 181 | Ga0466703_391162 | 3300042636 | Bacteria | 15224 |
| 182 | Ga0466727_062237 | 3300042655 | Bacteria | 1728 |
| 183 | Ga0466727_196576 | 3300042655 | Bacteria | 91619 |
| 184 | Ga0466715_559795 | 3300042616 | Bacteria | 1144 |
| 185 | Ga0123353_10201106 | 3300010167 | Bacteria | 3134 |
| 186 | Ga0123354_10296665 | 3300010882 | Bacteria | 1537 |
| 187 | 2227079680 | 2225789003 | Bacteria | 2031 |
| 188 | 2227538248 | 2225789004 | Bacteria | 3030 |
| 189 | JGI24702J35022_10019366 | 3300002462 | Bacteria | 3702 |
| 190 | JGI24705J35276_12237896 | 3300002504 | Bacteria | 13924 |
| 191 | Ga0466706_027020 | 3300042599 | Bacteria | 2616 |
| 192 | Ga0466706_079910 | 3300042599 | Bacteria | 19999 |
| 193 | Ga0466707_306917 | 3300042601 | Bacteria | 1178 |
| 194 | Ga0466707_353865 | 3300042601 | Bacteria | 1075 |
| 195 | Ga0466713_100680 | 3300042602 | Bacteria | 1084 |
| 196 | Ga0466713_124712 | 3300042602 | Bacteria | 7532 |
| 197 | Ga0466722_159566 | 3300042609 | Bacteria | 2355 |
| 198 | Ga0466692_181998 | 3300042591 | Bacteria | 19085 |
| 199 | Ga0466695_063144 | 3300042595 | Bacteria | 1475 |
| 200 | Ga0466695_257009 | 3300042595 | Bacteria | 1965 |
| 201 | Ga0466696_335694 | 3300042596 | Bacteria | 1164 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13601 | HTH_34 | Winged helix DNA-binding domain | 13 | 92 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.