Protein Family IF00927
Metagenome
Metatranscriptome
Isolate
190
Members
67
Samples
177
Scaffolds
89.16
Avg Length
Representative Sequence
- ID
- 3300002834|JGI24696J40584_12460039|JGI24696J40584_124600392
- Length
- 107 aa
- Sequence
- MGTFNGSTGSFIHVGEKMDLGEVTALLRQGVLQVLMIASPFLVSALVIGLVVAILQATMSVQEQTLTFVPKMLVILLVLALLGGWMFNSLGQYTINLFGNISNMAR*
Sample Types
Isolate
6.8%
Metagenome
92.1%
MAG
0.0%
Metatranscriptome
1.1%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.7%
Unclassified
22.2%
Kalotermitidae
22.2%
Rhinotermitidae
6.3%
Termopsidae
6.3%
Hodotermitidae
1.6%
Hydrophilidae
1.6%
Taxonomy
Archaea
0
Bacteria
182
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 2 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 17 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 18 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 19 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 20 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 21 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 22 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 32 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 35 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 43 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 44 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 45 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 48 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 49 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 50 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 51 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 52 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 53 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 54 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 55 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 57 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 58 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 59 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 60 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 61 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 62 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 63 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 64 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 65 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 66 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 67 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_123953 | 3300042614 | Bacteria | 1102 |
| 2 | Ga0466712_222986 | 3300042614 | Bacteria | 2590 |
| 3 | Ga0466718_158520 | 3300042617 | Bacteria | 1310 |
| 4 | Ga0466728_369583 | 3300042620 | Bacteria | 1604 |
| 5 | Ga0466690_258050 | 3300042590 | Bacteria | 2056 |
| 6 | Ga0466692_026279 | 3300042591 | Bacteria | 3079 |
| 7 | Ga0466696_492062 | 3300042596 | Bacteria | 2460 |
| 8 | Ga0466703_187864 | 3300042636 | Bacteria | 71803 |
| 9 | Ga0466709_303216 | 3300042648 | Unclassified | 2666 |
| 10 | Ga0466719_445909 | 3300042606 | Bacteria | 1634 |
| 11 | Ga0466698_186213 | 3300042610 | Bacteria | 2877 |
| 12 | JGI24698J34947_10246287 | 3300002449 | Bacteria | 670 |
| 13 | Ga0072941_1033176 | 3300005201 | Bacteria | 2924 |
| 14 | Ga0072941_1081978 | 3300005201 | Bacteria | 3737 |
| 15 | Ga0074263_137429 | 3300005485 | Bacteria | 899 |
| 16 | Ga0466732_169331 | 3300042656 | Bacteria | 16180 |
| 17 | Ga0123353_11596799 | 3300010167 | Bacteria | 824 |
| 18 | Ga0466712_008817 | 3300042614 | Bacteria | 6092 |
| 19 | Ga0466711_054871 | 3300042615 | Bacteria | 21842 |
| 20 | Ga0466718_091004 | 3300042617 | Bacteria | 3105 |
| 21 | Ga0466726_206083 | 3300042619 | Bacteria | 1051 |
| 22 | Ga0466728_330440 | 3300042620 | Bacteria | 14128 |
| 23 | Ga0466729_074719 | 3300042621 | Bacteria | 1050 |
| 24 | Ga0264413_106600 | 3300024493 | Bacteria | 7112 |
| 25 | Ga0456237_0001355 | 3300041968 | Bacteria | 3890 |
| 26 | Ga0456237_0007833 | 3300041968 | Bacteria | 1635 |
| 27 | Ga0466690_324568 | 3300042590 | Bacteria | 1146 |
| 28 | Ga0466692_052084 | 3300042591 | Bacteria | 1697 |
| 29 | Ga0466692_188385 | 3300042591 | Bacteria | 2827 |
| 30 | Ga0466693_306429 | 3300042592 | Bacteria | 23893 |
| 31 | Ga0466696_463433 | 3300042596 | Bacteria | 14944 |
| 32 | Ga0466703_109331 | 3300042636 | Bacteria | 5327 |
| 33 | Ga0466703_143773 | 3300042636 | Bacteria | 24097 |
| 34 | Ga0466703_191819 | 3300042636 | Bacteria | 1347 |
| 35 | Ga0466704_134136 | 3300042643 | Bacteria | 31349 |
| 36 | Ga0466704_295489 | 3300042643 | Bacteria | 9240 |
| 37 | Ga0466716_116176 | 3300042605 | Bacteria | 2652 |
| 38 | Ga0466720_063635 | 3300042607 | Unclassified | 4809 |
| 39 | Ga0466722_092646 | 3300042609 | Bacteria | 25709 |
| 40 | Ga0466698_048513 | 3300042610 | Bacteria | 1164 |
| 41 | JGI24698J34947_10006154 | 3300002449 | Bacteria | 6592 |
| 42 | JGI24695J34938_10028898 | 3300002450 | Unclassified | 2598 |
| 43 | JGI24696J40584_12460039 | 3300002834 | Bacteria | 580 |
| 44 | Ga0068305_10497294 | 3300005083 | Bacteria | 1237 |
| 45 | Ga0466733_125194 | 3300042659 | Bacteria | 1375 |
| 46 | Ga0466733_203228 | 3300042659 | Bacteria | 7479 |
| 47 | Ga0123353_11429771 | 3300010167 | Bacteria | 886 |
| 48 | Ga0466712_139157 | 3300042614 | Bacteria | 70891 |
| 49 | Ga0466715_642503 | 3300042616 | Bacteria | 2584 |
| 50 | Ga0466723_112988 | 3300042618 | Bacteria | 28451 |
| 51 | Ga0466690_026067 | 3300042590 | Bacteria | 36637 |
| 52 | Ga0466690_144218 | 3300042590 | Bacteria | 24655 |
| 53 | Ga0466690_323429 | 3300042590 | Bacteria | 1067 |
| 54 | Ga0466694_247586 | 3300042594 | Bacteria | 24298 |
| 55 | Ga0466694_325612 | 3300042594 | Bacteria | 1748 |
| 56 | Ga0466699_069890 | 3300042597 | Bacteria | 2290 |
| 57 | Ga0466731_397671 | 3300042622 | Bacteria | 1387 |
| 58 | Ga0466702_247371 | 3300042635 | Bacteria | 1201 |
| 59 | Ga0466709_284686 | 3300042648 | Bacteria | 1638 |
| 60 | Ga0466727_248331 | 3300042655 | Bacteria | 4614 |
| 61 | Ga0466716_377823 | 3300042605 | Bacteria | 2105 |
| 62 | Ga0466719_236506 | 3300042606 | Bacteria | 21926 |
| 63 | Ga0466722_106674 | 3300042609 | Bacteria | 11668 |
| 64 | JGI24695J34938_10005767 | 3300002450 | Bacteria | 7626 |
| 65 | JGI24699J35502_11072732 | 3300002509 | Bacteria | 1866 |
| 66 | Ga0068305_10013371 | 3300005083 | Bacteria | 5641 |
| 67 | Ga0072940_1004490 | 3300005200 | Bacteria | 8102 |
| 68 | Ga0072941_1054749 | 3300005201 | Bacteria | 3174 |
| 69 | Ga0466705_116715 | 3300042612 | Bacteria | 12168 |
| 70 | Ga0466732_237899 | 3300042656 | Bacteria | 3288 |
| 71 | Ga0466732_316565 | 3300042656 | Bacteria | 3912 |
| 72 | Ga0466732_426850 | 3300042656 | Bacteria | 6190 |
| 73 | Ga0466733_043896 | 3300042659 | Bacteria | 32052 |
| 74 | Ga0123353_10492553 | 3300010167 | Bacteria | 1789 |
| 75 | Ga0466705_467199 | 3300042612 | Bacteria | 2310 |
| 76 | Ga0466712_140906 | 3300042614 | Bacteria | 1707 |
| 77 | Ga0466711_379169 | 3300042615 | Bacteria | 28919 |
| 78 | Ga0466715_142809 | 3300042616 | Bacteria | 11642 |
| 79 | Ga0466715_406526 | 3300042616 | Bacteria | 3103 |
| 80 | Ga0466715_459047 | 3300042616 | Bacteria | 21424 |
| 81 | Ga0466715_564072 | 3300042616 | Bacteria | 16108 |
| 82 | Ga0466718_052335 | 3300042617 | Bacteria | 6884 |
| 83 | Ga0466723_353869 | 3300042618 | Bacteria | 5862 |
| 84 | Ga0466735_059245 | 3300042624 | Bacteria | 2561 |
| 85 | Ga0466704_281013 | 3300042643 | Bacteria | 21716 |
| 86 | Ga0466701_084110 | 3300042598 | Bacteria | 1122 |
| 87 | FAAS_10859574 | 3300001880 | Bacteria | 524 |
| 88 | JGI24698J34947_10038352 | 3300002449 | Unclassified | 2485 |
| 89 | JGI24695J34938_10006062 | 3300002450 | Bacteria | 7361 |
| 90 | JGI24695J34938_10014574 | 3300002450 | Bacteria | 4069 |
| 91 | Ga0068302_10440580 | 3300005071 | Bacteria | 683 |
| 92 | Ga0072941_1048480 | 3300005201 | Bacteria | 821 |
| 93 | Ga0466712_168271 | 3300042614 | Bacteria | 2078 |
| 94 | Ga0466718_018037 | 3300042617 | Bacteria | 12353 |
| 95 | Ga0466718_096172 | 3300042617 | Unclassified | 1461 |
| 96 | Ga0466728_200548 | 3300042620 | Bacteria | 1716 |
| 97 | Ga0222431_1087771 | 3300021190 | Bacteria | 738 |
| 98 | Ga0223677_1018258 | 3300021239 | Unclassified | 540 |
| 99 | Ga0466693_041452 | 3300042592 | Bacteria | 38277 |
| 100 | Ga0466691_129862 | 3300042593 | Bacteria | 25527 |
| 101 | Ga0466694_231755 | 3300042594 | Bacteria | 16003 |
| 102 | Ga0466694_281332 | 3300042594 | Bacteria | 3929 |
| 103 | Ga0466699_200774 | 3300042597 | Bacteria | 1332 |
| 104 | Ga0466699_243834 | 3300042597 | Bacteria | 9207 |
| 105 | Ga0466704_311146 | 3300042643 | Bacteria | 1806 |
| 106 | Ga0466724_50968 | 3300042649 | Bacteria | 11367 |
| 107 | Ga0466727_034049 | 3300042655 | Bacteria | 1188 |
| 108 | Ga0466719_544255 | 3300042606 | Bacteria | 14999 |
| 109 | Ga0466720_015289 | 3300042607 | Bacteria | 5293 |
| 110 | FAAS_10258592 | 3300001880 | Unclassified | 554 |
| 111 | JGI24698J34947_10000529 | 3300002449 | Bacteria | 18038 |
| 112 | Ga0466705_007122 | 3300042612 | Bacteria | 14710 |
| 113 | Ga0466705_190517 | 3300042612 | Bacteria | 4048 |
| 114 | Ga0123353_12413533 | 3300010167 | Bacteria | 628 |
| 115 | Ga0466712_022001 | 3300042614 | Bacteria | 2185 |
| 116 | Ga0466712_124421 | 3300042614 | Bacteria | 30150 |
| 117 | Ga0466715_462513 | 3300042616 | Bacteria | 17159 |
| 118 | Ga0466718_023879 | 3300042617 | Bacteria | 2382 |
| 119 | Ga0466718_134407 | 3300042617 | Bacteria | 16182 |
| 120 | Ga0466718_170237 | 3300042617 | Bacteria | 5170 |
| 121 | Ga0466723_199918 | 3300042618 | Bacteria | 15235 |
| 122 | Ga0466726_286198 | 3300042619 | Bacteria | 2356 |
| 123 | Ga0466656_223009 | 3300042550 | Bacteria | 1548 |
| 124 | Ga0466694_056769 | 3300042594 | Bacteria | 3665 |
| 125 | Ga0466694_129986 | 3300042594 | Bacteria | 29870 |
| 126 | Ga0466694_332587 | 3300042594 | Bacteria | 1189 |
| 127 | Ga0466731_200165 | 3300042622 | Bacteria | 1000 |
| 128 | Ga0466731_242282 | 3300042622 | Bacteria | 4644 |
| 129 | Ga0466708_440943 | 3300042652 | Bacteria | 2276 |
| 130 | Ga0466707_293662 | 3300042601 | Bacteria | 1023 |
| 131 | JGI24698J34947_10004036 | 3300002449 | Bacteria | 7976 |
| 132 | JGI24695J34938_10078920 | 3300002450 | Bacteria | 1362 |
| 133 | Ga0072940_1068566 | 3300005200 | Bacteria | 906 |
| 134 | Ga0072941_1039949 | 3300005201 | Bacteria | 10633 |
| 135 | Ga0123357_10116735 | 3300009784 | Bacteria | 3379 |
| 136 | Ga0123357_10280673 | 3300009784 | Bacteria | 1721 |
| 137 | Ga0466715_360152 | 3300042616 | Bacteria | 1615 |
| 138 | Ga0466723_064070 | 3300042618 | Bacteria | 37236 |
| 139 | Ga0466723_213987 | 3300042618 | Bacteria | 1639 |
| 140 | Ga0466726_098494 | 3300042619 | Bacteria | 33073 |
| 141 | Ga0264413_127028 | 3300024493 | Bacteria | 1041 |
| 142 | Ga0466692_152771 | 3300042591 | Bacteria | 3930 |
| 143 | Ga0466696_149692 | 3300042596 | Bacteria | 17333 |
| 144 | Ga0466696_331190 | 3300042596 | Bacteria | 65152 |
| 145 | Ga0466709_119097 | 3300042648 | Bacteria | 1180 |
| 146 | Ga0466709_322778 | 3300042648 | Bacteria | 1444 |
| 147 | Ga0466707_395941 | 3300042601 | Bacteria | 1881 |
| 148 | Ga0466716_339846 | 3300042605 | Bacteria | 1108 |
| 149 | Ga0466719_023777 | 3300042606 | Bacteria | 34238 |
| 150 | Ga0466698_016167 | 3300042610 | Bacteria | 1627 |
| 151 | JGI24698J34947_10000574 | 3300002449 | Bacteria | 17512 |
| 152 | JGI24698J34947_10019346 | 3300002449 | Bacteria | 3673 |
| 153 | JGI24698J34947_10056289 | 3300002449 | Bacteria | 1956 |
| 154 | Ga0123357_10000117 | 3300009784 | Bacteria | 67273 |
| 155 | Ga0123356_10007572 | 3300010049 | Bacteria | 10830 |
| 156 | Ga0123353_12787401 | 3300010167 | Bacteria | 573 |
| 157 | Ga0466712_264666 | 3300042614 | Bacteria | 18136 |
| 158 | Ga0466715_520406 | 3300042616 | Bacteria | 11619 |
| 159 | Ga0466718_006900 | 3300042617 | Bacteria | 1014 |
| 160 | Ga0466718_027579 | 3300042617 | Bacteria | 1925 |
| 161 | Ga0466718_161664 | 3300042617 | Bacteria | 3850 |
| 162 | Ga0466726_411040 | 3300042619 | Unclassified | 1195 |
| 163 | Ga0264413_105605 | 3300024493 | Bacteria | 26648 |
| 164 | Ga0466690_230211 | 3300042590 | Bacteria | 6260 |
| 165 | Ga0466692_043155 | 3300042591 | Bacteria | 1019 |
| 166 | Ga0466691_223209 | 3300042593 | Bacteria | 41344 |
| 167 | Ga0466694_006701 | 3300042594 | Bacteria | 1286 |
| 168 | Ga0466696_133072 | 3300042596 | Bacteria | 1071 |
| 169 | Ga0466699_160565 | 3300042597 | Bacteria | 10888 |
| 170 | Ga0466706_215847 | 3300042599 | Bacteria | 4887 |
| 171 | Ga0466719_372378 | 3300042606 | Bacteria | 27365 |
| 172 | Ga0466722_176365 | 3300042609 | Bacteria | 1012 |
| 173 | Ga0466722_236211 | 3300042609 | Bacteria | 2750 |
| 174 | JGI24702J35022_10036084 | 3300002462 | Bacteria | 2642 |
| 175 | Ga0072940_1032721 | 3300005200 | Bacteria | 2103 |
| 176 | Ga0072941_1073897 | 3300005201 | Bacteria | 4414 |
| 177 | Ga0074263_110404 | 3300005485 | Bacteria | 2316 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01313 | Bac_export_3 | Bacterial export proteins, family 3 | 23 | 94 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.